RubyGems - bioroebe - Versions diffs - 0.10.80 → 0.12.12 - Mend

bioroebe 0.10.80 → 0.12.12

This diff represents the content of publicly available package versions that have been released to one of the supported registries. The information contained in this diff is provided for informational purposes only and reflects changes between package versions as they appear in their respective public registries.

Potentially problematic release.

This version of bioroebe might be problematic. Click here for more details.

Files changed (242) hide show

data/lib/bioroebe/toplevel_methods/colourize_related_methods.rb ADDED Viewed

@@ -0,0 +1,164 @@
+#!/usr/bin/ruby -w
+# Encoding: UTF-8
+# frozen_string_literal: true
+# =========================================================================== #
+# === Bioroebe::Colourize
+#
+# This file can be used to colourize a string representing DNA (in fasta
+# format), for use (or display) on a website. HTML colour code and CSS
+# rules will be used.
+#
+# The colour to use can be passed via the second method to four of the
+# module-level methods in this file.
+# =========================================================================== #
+module Bioroebe
+module Colourize # === Bioroebe::Colourize
+  require 'bioroebe/colours/colours.rb'
+  require 'bioroebe/toplevel_methods/e.rb'
+  require 'bioroebe/toplevel_methods/file_and_directory_related_actions.rb'
+  # ========================================================================= #
+  # === Bioroebe::Colourize.generate_HTML_page_via_this_input
+  #
+  # This method will generate a .html page, using the default colourization
+  # rules defined in this file here.
+  # ========================================================================= #
+  def self.generate_HTML_page_via_this_input(i)
+    if i.is_a? Array
+      i = i.join(' ').strip
+    end
+    what = "<!DOCTYPE html>\n<html lang=\"en\"><head>"\
+           "<title>Colourized FASTA Sequence</title><style>\n".dup
+    what << "#{return_default_CSS_rules_to_use}\n\n"
+    what << "</style>\n</head>\n<body>\n"
+    result = colourize_this_FASTA_sequence(i)
+    what << "#{result}</body></html>\n"
+    # ======================================================================= #
+    # The name of the generated file is determined by the input
+    # argument given.
+    # ======================================================================= #
+    into = File.basename(i).delete_suffix(File.extname(i))+
+           '.html'
+    if File.exist? into
+      e 'Can not store into an already existing file.'
+    else
+      e 'Storing into the file '+::Bioroebe.sfile(into)+' next.'
+      ::Bioroebe.write_what_into(what, into)
+    end
+  end
+  # ========================================================================= #
+  # === Bioroebe::Colourize.return_default_CSS_rules_to_use
+  # ========================================================================= #
+  def self.return_default_CSS_rules_to_use
+    return '.lightgreen {
+  color: lightgreen;
+}
+.lightblue {
+  color: lightblue;
+}
+.mediumslateblue {
+  color: lightblue;
+}
+.olivedrab {
+  color: olivedrab;
+}
+body {
+  background-color: black;
+  color: white;
+  font-family: monospace;
+  font-size: 2em;
+}'
+  end
+  # ========================================================================= #
+  # === Bioroebe::Colourize.colourize_this_FASTA_sequence
+  # ========================================================================= #
+  def self.colourize_this_FASTA_sequence(
+      i = ARGV
+    )
+    if i.is_a? Array
+      i = i.join(' ').strip
+    end
+    if i and File.file?(i)
+      # unless Bioroebe.const_defined?(:ParseFasta)
+      #   require 'bioroebe/fasta_and_fastq/parse_fasta/parse_fasta.rb'
+      # end
+      # i = Bioroebe::ParseFasta.new(i) { :be_quiet }.sequence?
+      i = File.readlines(i).reject {|line|
+        line.start_with?('#','>')
+      }.join("\n")
+    end
+    result = colourize_TUG_start_codon(i)
+    result = colourize_TAG_stop_codon(result)
+    result = colourize_TAA_stop_codon(result)
+    result = colourize_TGA_stop_codon(result)
+    return result
+  end
+  # ========================================================================= #
+  # === Bioroebe::Colourize.colourize_TAG_stop_codon
+  # ========================================================================= #
+  def self.colourize_TAG_stop_codon(
+      i               = '',
+      use_this_colour = :lightblue
+    )
+    return i.gsub(
+      /(TA\n?G)/,
+      '<span class="'+use_this_colour.to_s+'">\1</span>'
+    )
+  end
+  # ========================================================================= #
+  # === Bioroebe::Colourize.colourize_TAA_stop_codon
+  # ========================================================================= #
+  def self.colourize_TAA_stop_codon(
+      i               = '',
+      use_this_colour = :lightgreen
+    )
+    return i.gsub(
+      /(TA\n?A)/,
+      '<span class="'+use_this_colour.to_s+'">\1</span>'
+    )
+  end
+  # ========================================================================= #
+  # === Bioroebe::Colourize.colourize_TGA_stop_codon
+  # ========================================================================= #
+  def self.colourize_TGA_stop_codon(
+      i               = '',
+      use_this_colour = :olivedrab
+    )
+    return i.gsub(
+      /(TG\n?A)/,
+      '<span class="'+use_this_colour.to_s+'">\1</span>'
+    )
+  end
+  # ========================================================================= #
+  # === Bioroebe::Colourize.colourize_TUG_start_codon
+  # ========================================================================= #
+  def self.colourize_TUG_start_codon(
+      i               = '',
+      use_this_colour = :mediumslateblue
+    )
+    return i.gsub(
+      /(TU\n?G)/,
+    '<span class="'+use_this_colour.to_s+'">\1</span>'
+    )
+  end
+end; end
+if __FILE__ == $PROGRAM_NAME
+  alias e puts
+  # e Bioroebe::Colourize.colourize_this_FASTA_sequence(ARGV)
+  Bioroebe::Colourize.generate_HTML_page_via_this_input(ARGV)
+end # colourizerelatedmethods alu_elements.fasta

data/lib/bioroebe/toplevel_methods/databases.rb CHANGED Viewed

@@ -15,7 +15,7 @@ module Bioroebe
   # can pass the password for the postgreSQL database.
   # ========================================================================= #
   def self.set_pgpassword(
-      new_password = POSTGRE_PASSWORD
+      new_password = Bioroebe::Postgresql::POSTGRE_PASSWORD
     )
     ENV['PGPASSWORD'] = new_password
   end; self.instance_eval { alias set_password set_pgpassword } # === Bioroebe.set_password

data/lib/bioroebe/toplevel_methods/digest.rb CHANGED Viewed

@@ -11,15 +11,17 @@ module Bioroebe
   #
   # Usage examples:
   #
-  #   Bioroebe.digest_this_dna(:lambda_genome, with: :EcoRI)
-  #   Bioroebe.digest_this_dna("/root/Bioroebe/fasta/NC_001416.1_Enterobacteria_phage_lambda_complete_genome.fasta", with: :EcoRI)
+  #   x = Bioroebe.digest_this_dna(:lambda_genome, with: :EcoRI)
+  #   x = Bioroebe.digest_this_dna("/root/Bioroebe/fasta/NC_001416.1_Enterobacteria_phage_lambda_complete_genome.fasta", with: :EcoRI)
+  #   x = Bioroebe.digest_this_dna("/Depot/j/foobar.fasta", with: :PvuII)
   #
   # ========================================================================= #
   def self.digest_this_dna(
-      this_DNA_sequence, hash = {}
+      this_DNA_sequence,
+      hash = {}
     )
-    require 'bioroebe/toplevel_methods/e.rb'
     require 'bioroebe/constants/files_and_directories.rb'
+    require 'bioroebe/toplevel_methods/e.rb'
     require 'bioroebe/fasta_and_fastq/parse_fasta/parse_fasta.rb'
     restriction_enzymes = Bioroebe.load_and_return_the_restriction_enzymes
     this_restriction_enzyme = nil
@@ -46,16 +48,24 @@ module Bioroebe
       target_sequence.chop!
       target_sequence.strip!
     end
-    if nucleotide_sequence.include?(target_sequence)
-      e 'Yes, this sequence is there.'
+    if nucleotide_sequence and
+       nucleotide_sequence.include?(target_sequence)
+      print rev+'Yes, the restriction-sequence '+
+            lightblue(target_sequence)+
+            rev+
+            ' is found in the given sequence. '
       scanned = nucleotide_sequence.scan(
         /#{target_sequence}/
       )
-      e "It can be found #{scanned.size.to_s} times."
+      erev "It can be found #{steelblue(scanned.size.to_s)}#{rev} "\
+           "times, at these positions:"
+      e
       sub_sequences = nucleotide_sequence.split(/#{target_sequence}/)
       sub_sequences.sort_by {|entry| entry.size }.reverse.each {|sequence|
-        pp sequence.size
+        erev "  #{sequence.size}"
       }
+      e
+      return sub_sequences
     else
       e 'Nothing found.'
     end

data/lib/bioroebe/toplevel_methods/fasta_and_fastq.rb CHANGED Viewed

@@ -49,68 +49,6 @@ module Bioroebe
     end
   end
-  # ========================================================================= #
-  # === Bioroebe.colourize_this_fasta_dna_sequence
-  #
-  # This toplevel method can be used to colourize a FASTA (DNA)
-  # sequence, e. g. "ATGCGCGTATTA" and so forth.
-  #
-  # Note that this is intended for the commandline, that is to be
-  # displayed on e. g. a KDE Konsole terminal.
-  #
-  # Usage example:
-  #
-  #   puts Bioroebe.colourize_this_fasta_dna_sequence('ATGCGCATGCGCGTATTAGTATTAATGCGCGTATTAATGCGCGTATTA')
-  #
-  # ========================================================================= #
-  def self.colourize_this_fasta_dna_sequence(
-      i = nil
-    )
-    if i.nil?
-      e 'Please provide a valid FASTA sequence as input to '\
-        'Bioroebe.colourize_this_fasta_dna_sequence()'
-      return
-    end
-    if i.is_a? Array
-      # ===================================================================== #
-      # Arrays will be joined together.
-      # ===================================================================== #
-      i = i.join(' ').strip
-    end
-    if i.is_a? String
-      # ===================================================================== #
-      # The colours are either defined in a file called
-      # 'colourize_fasta_sequences.yml' or they are simply hardcoded.
-      #
-      # The preferred (and thus default) way is to simply make use
-      # of that .yml file. That works on my home system, so it
-      # should work for other people as well.
-      # ===================================================================== #
-      if use_colours?
-        i = i.dup if i.frozen?
-        this_file = FILE_COLOURIZE_FASTA_SEQUENCES
-        if File.exist? this_file
-          dataset_for_the_colours = YAML.load_file(this_file)
-          dataset_for_the_colours.each_pair {|this_nucleotide, this_colour_to_be_used|
-            i.gsub!(
-              /#{this_nucleotide}/,
-              send(this_colour_to_be_used, this_nucleotide)+
-              rev
-            )
-          }
-        else
-          i.gsub!(/A/, "#{teal('A')}#{rev}")
-          i.gsub!(/C/, "#{slateblue('C')}#{rev}")
-          i.gsub!(/G/, "#{royalblue('G')}#{rev}")
-          i.gsub!(/T/, "#{steelblue('T')}#{rev}")
-          i.gsub!(/U/, "#{steelblue('U')}#{rev}") # Uracil is just the same as Thymine.
-        end
-      end
-    end
-    i
-  end; self.instance_eval { alias colourize_this_fasta_sequence colourize_this_fasta_dna_sequence } # === Bioroebe.colourize_this_fasta_sequence
-       self.instance_eval { alias colourized_parse_fasta        colourize_this_fasta_dna_sequence } # === Bioroebe.colourized_parse_fasta
   # ========================================================================= #
   # === Bioroebe.calculate_weight_of_the_aminoacids_in_this_fasta_file
   #
@@ -317,13 +255,119 @@ module Bioroebe
     end
   end
+  # ========================================================================= #
+  # === Bioroebe.colourize_this_fasta_dna_sequence
+  #
+  # This toplevel method can be used to colourize a FASTA (DNA)
+  # sequence, e. g. "ATGCGCGTATTA" and so forth.
+  #
+  # Note that this is intended for the commandline, that is to be
+  # displayed on e. g. a KDE Konsole terminal.
+  #
+  # Usage examples:
+  #
+  #   puts Bioroebe.colourize_this_fasta_dna_sequence('ATGCGCATGCGCGTATTAGTATTAATGCGCGTATTAATGCGCGTATTA')
+  #   puts Bioroebe.colourize_this_fasta_dna_sequence('ATGCGCATGCGCGTATTAGTATTAATGCGCGTATTAATGCGCGTATTA') { :with_ruler }
+  #   puts Bioroebe.colourize_this_fasta_dna_sequence('TGCGCGTATTAGTATTAATGCGCGTATTAATGCGCGTATTA') { :with_ruler_steelblue_colour }
+  #
+  # ========================================================================= #
+  def self.colourize_this_fasta_dna_sequence(
+      i = nil,
+      &block
+    )
+    unless ::Bioroebe.respond_to?(:ruler_return_as_string_without_colours)
+      require 'bioroebe/misc/ruler.rb'
+    end
+    if i.nil?
+      e 'Please provide a valid FASTA sequence as input to '\
+        'Bioroebe.colourize_this_fasta_dna_sequence()'
+      return
+    end
+    if i.is_a? Array
+      # ===================================================================== #
+      # Arrays will be joined together.
+      # ===================================================================== #
+      i = i.join(' ').strip
+    end
+    # ======================================================================= #
+    # Check for existing files next:
+    # ======================================================================= #
+    if i and File.file?(i)
+      i = File.read(i)
+    end
+    original_input = i.dup
+    i = i.dup # Always dup it here.
+    if i.is_a? String
+      # ===================================================================== #
+      # The colours are either defined in a file called
+      # 'colourize_fasta_sequences.yml' or they are simply hardcoded.
+      #
+      # The preferred (and thus default) way is to simply make use
+      # of that .yml file. That works on my home system, so it
+      # should work for other people as well.
+      # ===================================================================== #
+      if use_colours?
+        this_file = FILE_COLOURIZE_FASTA_SEQUENCES
+        if File.exist? this_file
+          dataset_for_the_colours = YAML.load_file(this_file)
+          dataset_for_the_colours.each_pair {|this_nucleotide, this_colour_to_be_used|
+            i.gsub!(
+              /#{this_nucleotide}/,
+              Colours.send(this_colour_to_be_used, this_nucleotide)+
+              rev
+            )
+          }
+        else
+          i.gsub!(/A/, "#{teal('A')}#{rev}")
+          i.gsub!(/C/, "#{slateblue('C')}#{rev}")
+          i.gsub!(/G/, "#{royalblue('G')}#{rev}")
+          i.gsub!(/T/, "#{steelblue('T')}#{rev}")
+          i.gsub!(/U/, "#{steelblue('U')}#{rev}") # Uracil is just the same as Thymine.
+        end
+      end
+    end
+    # ======================================================================= #
+    # === Handle blocks next
+    # ======================================================================= #
+    if block_given?
+      yielded = yield
+      case yielded
+      # ===================================================================== #
+      # === with_ruler
+      # ===================================================================== #
+      when :with_ruler,
+           :add_ruler,
+           :ruler
+        i.prepend(
+          ::Bioroebe.ruler_return_as_string_without_colours(original_input)+
+          "\n"
+        )
+      else # Assume something like:
+           #   :with_ruler_steelblue_colour
+        if yielded.to_s.include? 'colo' # This assumes "colour" or "color".
+          use_this_colour = yielded.to_s.sub(/_colou?r/,'').
+                                         sub(/with_ruler_/,'')
+          this_string = send(use_this_colour,
+            ::Bioroebe.ruler_return_as_string_without_colours(original_input)+
+            "\n"
+          )
+          i.prepend(this_string)
+        end
+      end
+    end
+    return i
+  end; self.instance_eval { alias colourize_this_fasta_sequence colourize_this_fasta_dna_sequence } # === Bioroebe.colourize_this_fasta_sequence
+       self.instance_eval { alias colourized_parse_fasta        colourize_this_fasta_dna_sequence } # === Bioroebe.colourized_parse_fasta
   # ========================================================================= #
   # === Bioroebe.show_fasta_header
   #
   # This ad-hoc method can be used to quickly show the first line of an
   # assumed .fasta file.
   # ========================================================================= #
-  def self.show_fasta_header(of_this_file)
+  def self.show_fasta_header(
+      of_this_file
+    )
     if of_this_file.is_a? Array
       of_this_file = of_this_file.first
     end

data/lib/bioroebe/toplevel_methods/file_and_directory_related_actions.rb CHANGED Viewed

@@ -13,6 +13,13 @@ module Bioroebe
   require 'bioroebe/colours/sfile.rb'
   require 'bioroebe/colours/sdir.rb'
+  # ========================================================================= #
+  # === Bioroebe.move_file
+  # ========================================================================= #
+  def self.move_file(a, b)
+    FileUtils.mv(a, b)
+  end
   # ========================================================================= #
   # === Bioroebe.pwd                                                (pwd tag)
   #
@@ -134,6 +141,9 @@ module Bioroebe
       be_verbose = false
     )
     case be_verbose
+    # ======================================================================= #
+    # === :do_report_current_directory
+    # ======================================================================= #
     when :do_report_current_directory,
          :be_verbose
       be_verbose = true
@@ -160,12 +170,14 @@ module Bioroebe
     # Bioroebe.save_dir? is defined in bioroebe/toplevel_methods/store_here.rb.
     # ======================================================================= #
     when 'base',
-         'logdir'
+         'logdir',
+         :bioroebe_log_directory
       # ===================================================================== #
       # Enter the main log dir, unless a file exists with the same name.
       # ===================================================================== #
-      i = save_dir? unless File.exist? i
+      i = save_dir? unless File.exist?(i.to_s) # .to_s to avoid Symbols here.
     end
+    i = i.dup if i.is_a?(String) and i.frozen?
     i << '/' unless i.end_with? '/'
     if File.directory? i
       e sdir(i) if be_verbose # Also colourize the directory and output it.

data/lib/bioroebe/toplevel_methods/frequencies.rb CHANGED Viewed

@@ -10,6 +10,7 @@ module Bioroebe
   require 'bioroebe/project/project.rb'
   require 'bioroebe/toplevel_methods/e.rb'
   require 'bioroebe/colours/colours.rb'
+  require 'bioroebe/codons/convert_this_codon_to_that_aminoacid.rb'
   # ========================================================================= #
   # === Bioroebe.calculate_the_frequencies_of_this_species
@@ -34,7 +35,7 @@ module Bioroebe
     when :homo_sapiens,
          :homo,
          :human
-      i = "#{::Bioroebe.project_base_directory?}"\
+      i = "#{project_base_directory?}"\
           "codon_tables/frequencies/9606_Homo_sapiens.yml"
     end
     hash = YAML.load_file(i)
@@ -87,6 +88,12 @@ module Bioroebe
 end
 if __FILE__ == $PROGRAM_NAME
+  alias e puts
+  e
   Bioroebe.calculate_the_frequencies_of_this_species(ARGV)
+  e
+  e 'Aminoacid frequency:'
+  e; print '  '
   pp Bioroebe.aminoacid_frequency('MVTDEGAIYFTKDAARNWKAAVEETVSATLNRTVSSGITGASYYTGTFST')
+  e
 end # calculatethefrequenciesofthisspecies

data/lib/bioroebe/toplevel_methods/misc.rb CHANGED Viewed

@@ -14,21 +14,58 @@ module Bioroebe
   require 'bioroebe/toplevel_methods/e.rb'
   require 'bioroebe/toplevel_methods/esystem.rb'
   require 'bioroebe/toplevel_methods/extract.rb'
+  #require 'bioroebe/toplevel_methods/file_and_directory_related_actions.rb'
   # ========================================================================= #
-  # === Bioroebe.thousand_percentage
+  # === Bioroebe.sequence_based_on_these_restriction_enzymes
+  #
+  # Usage example:
+  #
+  #   x = Bioroebe.sequence_based_on_these_restriction_enzymes(%w( EcoRI SacI KpnI XmaI BamHI XbaI SalI )); 'GAATTCGAGCTCGGTACCCCCGGGGGATCCTCTAGAGTCGAC'
   #
-  # This method is solely a helper-method for Bioroebe.frequency_per_thousand().
   # ========================================================================= #
-  def self.thousand_percentage(
-      this_codon_n_times =   1,
-      total_n_elements  = 1000
-    )
-    result = (
-      (this_codon_n_times * 1000.0) / total_n_elements.to_f
-    ).round(1)
-    padded_result = result.to_s.rjust(5, ' ')
-    return padded_result
+  def self.sequence_based_on_these_restriction_enzymes(*i)
+    require 'bioroebe/enzymes/restriction_enzyme.rb'
+    _ = ''.dup
+    i.flatten.each {|this_restriction_enzyme|
+      _ << ::Bioroebe.restriction_sites?(this_restriction_enzyme)
+    }
+    return _
+  end
+  # ========================================================================= #
+  # === Bioroebe.create_jar_archive
+  #
+  # This method will create a .jar file.
+  #
+  # To invoke it from the commandline do:
+  #
+  #   bioroebe --jar
+  #
+  # To execute a .jar file do:
+  #
+  #   java -jar foobar.jar
+  #
+  # ========================================================================= #
+  def self.create_jar_archive
+    e 'Creating a .jar archive next:'
+    e
+    original_dir = return_pwd
+    cd '/home/x/programming/ruby/src/bioroebe/lib/bioroebe/java/bioroebe/src/main/java/'
+    esystem 'jar cf bioroebe.jar bioroebe/'
+    target_file = File.absolute_path('bioroebe.jar')
+    cd original_dir
+    if File.exist? target_file
+      e 'Moving the created .jar file into the current working '\
+        'directory next.'
+      move_file(target_file, original_dir)
+      e 'It should now be at:'
+      e
+      e sfile("  #{original_dir}#{File.basename(target_file)}")
+      e
+    end
+#   esystem 'jar cfe bioroebe.jar myClass myClass.class'
+    e
   end
   # ========================================================================= #
@@ -86,6 +123,7 @@ EOF
   # Usage example:
   #
   #   Bioroebe.codon_frequency_of_this_string
+  #   Bioroebe.codon_frequency_of_this_string 'ATTCGTACGATCGACTACTACT' # => {"UAC"=>2, "GAC"=>1, "AUC"=>1, "ACG"=>1, "CGU"=>1, "AUU"=>1}
   #
   # ========================================================================= #
   def self.codon_frequency_of_this_string(
@@ -107,6 +145,22 @@ EOF
     return sorted_hash
   end
+  # ========================================================================= #
+  # === Bioroebe.thousand_percentage
+  #
+  # This method is solely a helper-method for Bioroebe.frequency_per_thousand().
+  # ========================================================================= #
+  def self.thousand_percentage(
+      this_codon_n_times =   1,
+      total_n_elements  = 1000
+    )
+    result = (
+      (this_codon_n_times * 1000.0) / total_n_elements.to_f
+    ).round(1)
+    padded_result = result.to_s.rjust(5, ' ')
+    return padded_result
+  end
   # ========================================================================= #
   # === Bioroebe.align_this_string_via_multiple_sequence_alignment
   #
@@ -314,7 +368,13 @@ EOF
   # ========================================================================= #
   # === Bioroebe.bisulfite_treatment
   #
-  # Simply convert all C into U.
+  # Simply convert all C into U. The underlying idea here is that
+  # bilsufite will convert unmethylated Cytosines into Uracil.
+  #
+  # Usage example:
+  #
+  #   Bioroebe.bisulfite_treatment('CCCGCAATGCATACCTCGCCG') # => "UUUGUAATGUATAUUTUGUUG"
+  #
   # ========================================================================= #
   def self.bisulfite_treatment(i)
     if i.is_a? Array
@@ -420,6 +480,76 @@ EOF
   end; self.instance_eval { alias on_windows?    windows_platform? } # === Bioroebe.on_windows?
        self.instance_eval { alias is_on_windows? windows_platform? } # === Bioroebe.is_on_windows?
+  # ========================================================================= #
+  # === Bioroebe.two_dimensional_plot
+  #
+  # This method makes use of gnuplot to draw a 2D plot.
+  #
+  # The first argument should contain your dataset, as a String.
+  # ========================================================================= #
+  def self.two_dimensional_plot(
+      dataset =  '6 12
+8 14
+10 18
+12 23
+14 28
+16 29
+18 26
+20 23
+22 20',
+      optional_hash = {
+        width:    800,
+        height:   640
+      }
+    )
+    # ======================================================================= #
+    # Provide some generic fall-back values for width and height next:
+    # ======================================================================= #
+    width  = 1000
+    height =  800
+    _ = optional_hash
+    if _.is_a? Hash
+      # ===================================================================== #
+      # === :width
+      # ===================================================================== #
+      if _.has_key? :width
+        width = _.delete(:width)
+      end
+      # ===================================================================== #
+      # === :height
+      # ===================================================================== #
+      if _.has_key? :height
+        height = _.delete(:height)
+      end
+    end
+    # ======================================================================= #
+    # Go to a safe base directory.
+    # ======================================================================= #
+    cd :bioroebe_log_directory
+    mkdir 'gnuplot' unless File.directory?('gnuplot')
+    cd 'gnuplot'
+    # ======================================================================= #
+    # First save the dataset into dataset.md:
+    # ======================================================================= #
+    into = File.absolute_path('dataset.md')
+    e 'Storing the dataset into '+sfile(into)+' next.'
+    write_what_into(dataset, into)
+    what = <<-EOF
+set terminal png size #{width},#{height} enhanced font "Helvetica, 18"
+set output 'fancy_graph.png'
+plot '#{into}' with linespoints ls 1 notitle
+EOF
+    into = File.absolute_path('gnuplot.file')
+    e 'Storing into '+into+'.'
+    write_what_into(what, into)
+    esystem 'gnuplot '+into
+    if File.exist? 'fancy_graph.png' and is_on_roebe?
+      Open.in_browser('fancy_graph.png')
+    end
+  end
 end
 if __FILE__ == $PROGRAM_NAME