tencentcloud-sdk-python-intl-en 3.0.1078__py2.py3-none-any.whl → 3.0.1079__py2.py3-none-any.whl

tencentcloud/__init__.py

@@ -13,4 +13,4 @@
 # See the License for the specific language governing permissions and
 # limitations under the License.
 
-__version__ = '3.0.1078'
+__version__ = '3.0.1079'

tencentcloud/apigateway/v20180808/models.py

@@ -2835,7 +2835,7 @@ class AttachPluginRequest(AbstractModel):
         r"""
         :param _PluginId: ID of the bound API gateway plugin.
         :type PluginId: str
-        :param _ServiceId: ID of the service to be operated
+        :param _ServiceId: ID of the service to be operated.
         :type ServiceId: str
         :param _EnvironmentName: Environment for operating the API.
         :type EnvironmentName: str
@@ -2860,7 +2860,7 @@ class AttachPluginRequest(AbstractModel):
 
     @property
     def ServiceId(self):
-        """ID of the service to be operated
+        """ID of the service to be operated.
         :rtype: str
         """
         return self._ServiceId
@@ -7158,14 +7158,14 @@ class DeleteAPIDocRequest(AbstractModel):
 
     def __init__(self):
         r"""
-        :param _ApiDocId: API document ID
+        :param _ApiDocId: API document ID.
         :type ApiDocId: str
         """
         self._ApiDocId = None
 
     @property
     def ApiDocId(self):
-        """API document ID
+        """API document ID.
         :rtype: str
         """
         return self._ApiDocId
@@ -7194,7 +7194,7 @@ class DeleteAPIDocResponse(AbstractModel):
 
     def __init__(self):
         r"""
-        :param _Result: Whether the operation succeeded
+        :param _Result: Whether the operation succeeded.
         :type Result: bool
         :param _RequestId: The unique request ID, generated by the server, will be returned for every request (if the request fails to reach the server for other reasons, the request will not obtain a RequestId). RequestId is required for locating a problem.
         :type RequestId: str
@@ -7204,7 +7204,7 @@ class DeleteAPIDocResponse(AbstractModel):
 
     @property
     def Result(self):
-        """Whether the operation succeeded
+        """Whether the operation succeeded.
         :rtype: bool
         """
         return self._Result

tencentcloud/ciam/v20220331/models.py

@@ -1180,13 +1180,13 @@ class Filter(AbstractModel):
 
 
 class ImportUser(AbstractModel):
-    """Imported user information
-    1. One of the eight attributes of `UserName`, `PhoneNumber`, `Email`, `WechatOpenId`, `WechatUnionId`, `AlipayUserId`, `QqOpenId`, and `QqUnionId` must be included during import and comply with the regular expression rules for initializing custom attributes. The regular expressions for `UserName`, `PhoneNumber`, and `Email` can be queried in the custom attributes in the console.
-    2. For password import, the imported password supports plaintext import, MD5 ciphertext import, SHA1 ciphertext import, and BCRYPT ciphertext import. This needs to be specified in the `PasswordEncryptTypeEnum` field.
-    3. `IdentityVerified` and `IdentityVerificationMethod` can be imported.
-    If `IdentityVerified` is `true`, `IdentityVerificationMethod` is required.
-    If `IdentityVerificationMethod` is `nameAndIdCard`, `Name` and `ResidentIdentityCard` are required.
-    If `IdentityVerificationMethod` is `nameIdCardAndPhone`, `Name`, `PhoneNumber`, and `ResidentIdentityCard` are required.
+    """Import user information.
+    1. At least one of the following nine attributes should be included during the import: UserName, PhoneNumber, Email, WeChatOpenId, WeChatUnionId, AlipayUserId, QQOpenId, QQUnionId, and WeComUserId. Each of these attributes should adhere to the regular expression rules for initial custom attributes. The regular expressions for UserName, PhoneNumber, and Email can be queried in Custom Attributes on the console.
+    2. For the import of passwords, plaintext import, MD5 ciphertext import, SHA1 ciphertext import, and BCRYPT ciphertext import are supported. The import method should be specified in the PasswordEncryptTypeEnum field.
+    3. IdentityVerified and IdentityVerificationMethod can be imported.
+    When IdentityVerified is true, IdentityVerificationMethod should be entered.
+    When IdentityVerificationMethod is nameAndIdCard, Name and ResidentIdentityCard should be entered.
+    When IdentityVerificationMethod is nameIdCardAndPhone, Name, PhoneNumber, and ResidentIdentityCard should be entered.
 
     """
 
@@ -1216,6 +1216,8 @@ class ImportUser(AbstractModel):
         :type WechatUnionId: str
         :param _AlipayUserId: `alipayUserId` on Alipay
         :type AlipayUserId: str
+        :param _WeComUserId: WeCom user ID.
+        :type WeComUserId: str
         :param _Description: Description
         :type Description: str
         :param _Birthdate: Date of birth
@@ -1267,6 +1269,7 @@ class ImportUser(AbstractModel):
         self._WechatOpenId = None
         self._WechatUnionId = None
         self._AlipayUserId = None
+        self._WeComUserId = None
         self._Description = None
         self._Birthdate = None
         self._Name = None
@@ -1419,6 +1422,17 @@ class ImportUser(AbstractModel):
     def AlipayUserId(self, AlipayUserId):
         self._AlipayUserId = AlipayUserId
 
+    @property
+    def WeComUserId(self):
+        """WeCom user ID.
+        :rtype: str
+        """
+        return self._WeComUserId
+
+    @WeComUserId.setter
+    def WeComUserId(self, WeComUserId):
+        self._WeComUserId = WeComUserId
+
     @property
     def Description(self):
         """Description
@@ -1642,6 +1656,7 @@ class ImportUser(AbstractModel):
         self._WechatOpenId = params.get("WechatOpenId")
         self._WechatUnionId = params.get("WechatUnionId")
         self._AlipayUserId = params.get("AlipayUserId")
+        self._WeComUserId = params.get("WeComUserId")
         self._Description = params.get("Description")
         self._Birthdate = params.get("Birthdate")
         self._Name = params.get("Name")
@@ -3924,6 +3939,9 @@ Note: This field may return null, indicating that no valid values can be obtaine
         :param _AlipayUserId: `AlipayUserId` on Alipay
 Note: This field may return null, indicating that no valid values can be obtained.
         :type AlipayUserId: str
+        :param _WeComUserId: WeCom user ID.
+Note: This field may return null, indicating that no valid values can be obtained.
+        :type WeComUserId: str
         :param _Description: Description
 Note: This field may return null, indicating that no valid values can be obtained.
         :type Description: str
@@ -4008,6 +4026,7 @@ Note: this field may return null, indicating that no valid values can be obtaine
         self._WechatOpenId = None
         self._WechatUnionId = None
         self._AlipayUserId = None
+        self._WeComUserId = None
         self._Description = None
         self._Name = None
         self._Locale = None
@@ -4266,6 +4285,18 @@ Note: This field may return null, indicating that no valid values can be obtaine
     def AlipayUserId(self, AlipayUserId):
         self._AlipayUserId = AlipayUserId
 
+    @property
+    def WeComUserId(self):
+        """WeCom user ID.
+Note: This field may return null, indicating that no valid values can be obtained.
+        :rtype: str
+        """
+        return self._WeComUserId
+
+    @WeComUserId.setter
+    def WeComUserId(self, WeComUserId):
+        self._WeComUserId = WeComUserId
+
     @property
     def Description(self):
         """Description
@@ -4545,6 +4576,7 @@ Note: this field may return null, indicating that no valid values can be obtaine
         self._WechatOpenId = params.get("WechatOpenId")
         self._WechatUnionId = params.get("WechatUnionId")
         self._AlipayUserId = params.get("AlipayUserId")
+        self._WeComUserId = params.get("WeComUserId")
         self._Description = params.get("Description")
         self._Name = params.get("Name")
         self._Locale = params.get("Locale")

tencentcloud/ocr/v20181119/models.py

@@ -8653,7 +8653,7 @@ One of ImageUrl and ImageBase64 of the image must be provided. If both are provi
         :param _BackImageBase64: Base64 value of the image on the back of the card. Supported image formats: PNG, JPG, JPEG. The GIF format is not supported yet. Supported image size: The downloaded image does not exceed 7M after Base64 encoding. The image download takes no more than 3 seconds. One of ImageUrl and ImageBase64 of the image must be provided. If both are provided, only ImageUrl will be used.
         :type BackImageBase64: str
         :param _Config: The following optional fields are of string type and are empty by default: 
-RetImage: whether to return the processed image (base64 encrypted string); the value and meaning of RetImage are as follows: 1.preprocess returns the preprocessed image data 2.portrait Return portrait image data 3."" Do not return image data SDK setting method reference: Config = Json.stringify({"RetImage":"preprocess"}) API 3.0 Explorer setting method reference: Config = {"RetImage":"portrait" }
+RetImage: whether to return the processed image (base64 encrypted string); the value and meaning of RetImage are as follows: 1.portrait Return portrait image data 2."" Do not return image data SDK setting method reference: Config = Json.stringify({"RetImage":"portrait"}) API 3.0 Explorer setting method reference: Config = {"RetImage":"portrait" }
         :type Config: str
         """
         self._ImageUrl = None
@@ -8713,7 +8713,7 @@ One of ImageUrl and ImageBase64 of the image must be provided. If both are provi
     @property
     def Config(self):
         """The following optional fields are of string type and are empty by default: 
-RetImage: whether to return the processed image (base64 encrypted string); the value and meaning of RetImage are as follows: 1.preprocess returns the preprocessed image data 2.portrait Return portrait image data 3."" Do not return image data SDK setting method reference: Config = Json.stringify({"RetImage":"preprocess"}) API 3.0 Explorer setting method reference: Config = {"RetImage":"portrait" }
+RetImage: whether to return the processed image (base64 encrypted string); the value and meaning of RetImage are as follows: 1.portrait Return portrait image data 2."" Do not return image data SDK setting method reference: Config = Json.stringify({"RetImage":"portrait"}) API 3.0 Explorer setting method reference: Config = {"RetImage":"portrait" }
         :rtype: str
         """
         return self._Config

tencentcloud/teo/v20220901/errorcodes.py

@@ -20,10 +20,10 @@ DRYRUNOPERATION = 'DryRunOperation'
 # Operation failed.
 FAILEDOPERATION = 'FailedOperation'
 
-# Failed to publish: The certificate has expired. 
+# The edge HTTPS certificate has expired. Issuing expired certificates is currently not supported.
 FAILEDOPERATION_CERTIFICATEHASEXPIRED = 'FailedOperation.CertificateHasExpired'
 
-# The certificate does not exist.
+# The edge HTTPS certificate does not exist.
 FAILEDOPERATION_CERTIFICATENOTFOUND = 'FailedOperation.CertificateNotFound'
 
 # Syntax error in the condition expression of the configuration file.
@@ -62,6 +62,9 @@ FAILEDOPERATION_CREATECLSLOGTOPICTASKFAILED = 'FailedOperation.CreateClsLogTopic
 # Authentication failed while creating a custom push task. Check whether the push address is correct.
 FAILEDOPERATION_CREATELOGTOPICTASKAUTHFAILURE = 'FailedOperation.CreateLogTopicTaskAuthFailure'
 
+# 
+FAILEDOPERATION_EDGECLIENTCERTIFICATEHASEXPIRED = 'FailedOperation.EdgeClientCertificateHasExpired'
+
 # Another task is being deployed. Please try again later.
 FAILEDOPERATION_FUNCTIONDEPLOYING = 'FailedOperation.FunctionDeploying'
 
@@ -89,6 +92,9 @@ FAILEDOPERATION_RULEOPERATIONCONFLICT = 'FailedOperation.RuleOperationConflict'
 # Unknown configuration group type.
 FAILEDOPERATION_UNKNOWNCONFIGGROUPTYPE = 'FailedOperation.UnknownConfigGroupType'
 
+# 
+FAILEDOPERATION_UPSTREAMCLIENTCERTIFICATEHASEXPIRED = 'FailedOperation.UpstreamClientCertificateHasExpired'
+
 # Internal error.
 INTERNALERROR = 'InternalError'
 
@@ -137,6 +143,9 @@ INVALIDPARAMETER_ACCESSREDIRECTREGEXERROR = 'InvalidParameter.AccessRedirectRege
 # Too many attempts. Please try again later.
 INVALIDPARAMETER_ACTIONINPROGRESS = 'InvalidParameter.ActionInProgress'
 
+# Alias domain names do not support configuring a keyless certificate.
+INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTKEYLESS = 'InvalidParameter.AliasDomainNotSupportKeyless'
+
 # Chinese SM certificates are not supported for alias domain names.
 INVALIDPARAMETER_ALIASDOMAINNOTSUPPORTSMCERT = 'InvalidParameter.AliasDomainNotSupportSMCert'
 
@@ -152,18 +161,21 @@ INVALIDPARAMETER_CACHEKEYQUERYSTRINGREQUIRESFULLURLCACHEOFF = 'InvalidParameter.
 # The query string has too many values.
 INVALIDPARAMETER_CACHEKEYQUERYSTRINGTOOMANYVALUE = 'InvalidParameter.CacheKeyQueryStringTooManyValue'
 
-# Mismatch between the HTTPS certificate and the domain name.
+# Invalid edge HTTPS certificate configuration. The certificate does not match the domain name.
 INVALIDPARAMETER_CERTNOTMATCHDOMAIN = 'InvalidParameter.CertNotMatchDomain'
 
 # Internal error.
 INVALIDPARAMETER_CERTSYSTEMERROR = 'InvalidParameter.CertSystemError'
 
-# The HTTPS certificate is about to expire.
+# The edge HTTPS certificate is about to expire.
 INVALIDPARAMETER_CERTTOEXPIRE = 'InvalidParameter.CertToExpire'
 
-# Certificate error.
+# Invalid edge HTTPS certificate configuration. The key length does not meet the minimum requirement RSA>=2048, DSA>=2048, DH>=2048, and EC>=225.
 INVALIDPARAMETER_CERTTOOSHORTKEYSIZE = 'InvalidParameter.CertTooShortKeySize'
 
+# The domain name to be changed is not bound to a certificate or keyless server. Please bind it first and then proceed.
+INVALIDPARAMETER_CERTIFICATECONFLICTWITHKEYLESSSERVER = 'InvalidParameter.CertificateConflictWithKeylessServer'
+
 # IPv6 access conflicts with client IP geographical location.
 INVALIDPARAMETER_CLIENTIPCOUNTRYCONFLICTSWITHIPV6 = 'InvalidParameter.ClientIpCountryConflictsWithIpv6'
 
@@ -188,6 +200,9 @@ INVALIDPARAMETER_DOMAINONTRAFFICSCHEDULING = 'InvalidParameter.DomainOnTrafficSc
 # Duplicate rules.
 INVALIDPARAMETER_DUPLICATERULE = 'InvalidParameter.DuplicateRule'
 
+# 
+INVALIDPARAMETER_EDGECLIENTCERTCHECKERROR = 'InvalidParameter.EdgeClientCertCheckError'
+
 # The current conditions do not support the requested operation.
 INVALIDPARAMETER_ERRACTIONUNSUPPORTTARGET = 'InvalidParameter.ErrActionUnsupportTarget'
 
@@ -356,7 +371,7 @@ INVALIDPARAMETER_INVALIDCACHEONLYONSWITCH = 'InvalidParameter.InvalidCacheOnlyOn
 # Invalid node cache validity.
 INVALIDPARAMETER_INVALIDCACHETIME = 'InvalidParameter.InvalidCacheTime'
 
-# Incorrect certificate information.
+# Invalid edge HTTPS certificate information.
 INVALIDPARAMETER_INVALIDCERTINFO = 'InvalidParameter.InvalidCertInfo'
 
 # Invalid client IP location configuration. HeaderName consists of 1-100 alphanumeric characters and cannot start or end with hyphens (-).
@@ -395,7 +410,7 @@ INVALIDPARAMETER_INVALIDFORCEREDIRECTTYPE = 'InvalidParameter.InvalidForceRedire
 # Invalid parameter "https".
 INVALIDPARAMETER_INVALIDHTTPS = 'InvalidParameter.InvalidHttps'
 
-# Invalid HTTPS certificate.
+# Invalid edge HTTPS certificate configuration. The certificate content is invalid.
 INVALIDPARAMETER_INVALIDHTTPSCERTINFO = 'InvalidParameter.InvalidHttpsCertInfo'
 
 # The cipher suite does not match the TLS version.
@@ -557,6 +572,24 @@ INVALIDPARAMETER_LENGTHEXCEEDSLIMIT = 'InvalidParameter.LengthExceedsLimit'
 # The Cloud Load Balancer instance ID is required in the operation of modifying the origin server.
 INVALIDPARAMETER_LOADBALANCEINSTANCEIDISREQUIRED = 'InvalidParameter.LoadBalanceInstanceIdIsRequired'
 
+# The Layer-4 proxy service referencing a LoadBalancer is being deployed. Please edit later.
+INVALIDPARAMETER_LOADBALANCERBINDL4NOTINSTABLESTATUS = 'InvalidParameter.LoadBalancerBindL4NotInStableStatus'
+
+# The Layer-7 domain name service referencing a LoadBalancer is being deployed. Please edit later.
+INVALIDPARAMETER_LOADBALANCERBINDL7NOTINSTABLESTATUS = 'InvalidParameter.LoadBalancerBindL7NotInStableStatus'
+
+# The LoadBalancer names under the same site should be unique.
+INVALIDPARAMETER_LOADBALANCERNAMEREPEATED = 'InvalidParameter.LoadBalancerNameRepeated'
+
+# The LoadBalancer is used in a Layer-4 proxy.
+INVALIDPARAMETER_LOADBALANCERUSEDINL4PROXY = 'InvalidParameter.LoadBalancerUsedInL4Proxy'
+
+# The LoadBalancer is used in a Layer-7 domain name.
+INVALIDPARAMETER_LOADBALANCERUSEDINL7DOMAIN = 'InvalidParameter.LoadBalancerUsedInL7Domain'
+
+# The LoadBalancer is used in a rule engine.
+INVALIDPARAMETER_LOADBALANCERUSEDINRULEENGINE = 'InvalidParameter.LoadBalancerUsedInRuleEngine'
+
 # Modification parameters are missing.
 INVALIDPARAMETER_MODIFYPARAMETERSMISSING = 'InvalidParameter.ModifyParametersMissing'
 
@@ -569,6 +602,9 @@ INVALIDPARAMETER_NOTSUPPORTTHISPRESET = 'InvalidParameter.NotSupportThisPreset'
 # The domain name is configured to forward requests to the origin directly. iSmart Acceleration must be enabled.
 INVALIDPARAMETER_OCDIRECTORIGINREQUIRESSMARTROUTING = 'InvalidParameter.OCDirectOriginRequiresSmartRouting'
 
+# The type of the origin server group does not match the LoadBalancer type.
+INVALIDPARAMETER_ORIGINGROUPTYPECANNOTMATCHLBTYPE = 'InvalidParameter.OriginGroupTypeCanNotMatchLBType'
+
 # The origin address cannot be a private IP address.
 INVALIDPARAMETER_ORIGINISINNERIP = 'InvalidParameter.OriginIsInnerIp'
 
@@ -656,6 +692,9 @@ INVALIDPARAMETER_SECURITY = 'InvalidParameter.Security'
 # Configuration parameter error.
 INVALIDPARAMETER_SETTINGINVALIDPARAM = 'InvalidParameter.SettingInvalidParam'
 
+# Some bound origin server groups do not exist.
+INVALIDPARAMETER_SOMEORIGINGROUPNOTEXIST = 'InvalidParameter.SomeOriginGroupNotExist'
+
 # Shield Space is not bound with an origin. 
 INVALIDPARAMETER_SPACENOTBINDORIGIN = 'InvalidParameter.SpaceNotBindOrigin'
 
@@ -683,6 +722,9 @@ INVALIDPARAMETER_TOOMANYFILTERS = 'InvalidParameter.TooManyFilters'
 # Invalid file upload link.
 INVALIDPARAMETER_UPLOADURL = 'InvalidParameter.UploadUrl'
 
+# 
+INVALIDPARAMETER_UPSTREAMCLIENTCERTCHECKERROR = 'InvalidParameter.UpstreamClientCertCheckError'
+
 # The site is already bound.
 INVALIDPARAMETER_ZONEHASBEENBOUND = 'InvalidParameter.ZoneHasBeenBound'
 
@@ -704,12 +746,27 @@ INVALIDPARAMETERVALUE = 'InvalidParameterValue'
 # The domain name for this zone has been banned.
 INVALIDPARAMETERVALUE_ACCESSBLACKLIST = 'InvalidParameterValue.AccessBlacklist'
 
+# 
+INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTEDGEMTLS = 'InvalidParameterValue.AliasDomainNotSupportEdgeMTLS'
+
+# 
+INVALIDPARAMETERVALUE_ALIASDOMAINNOTSUPPORTUPSTREAMMTLS = 'InvalidParameterValue.AliasDomainNotSupportUpstreamMTLS'
+
 # 
 INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTMUSTCA = 'InvalidParameterValue.CertificateVerifyClientMustCa'
 
 # 
 INVALIDPARAMETERVALUE_CERTIFICATEVERIFYCLIENTNEEDCERT = 'InvalidParameterValue.CertificateVerifyClientNeedCert'
 
+# 
+INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTRSAORECC = 'InvalidParameterValue.CertificateVerifyUpstreamClientMustRSAorECC'
+
+# 
+INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTMUSTSVR = 'InvalidParameterValue.CertificateVerifyUpstreamClientMustSVR'
+
+# 
+INVALIDPARAMETERVALUE_CERTIFICATEVERIFYUPSTREAMCLIENTNEEDCERT = 'InvalidParameterValue.CertificateVerifyUpstreamClientNeedCert'
+
 # 
 INVALIDPARAMETERVALUE_CLIENTCERTINFOQUOTALIMIT = 'InvalidParameterValue.ClientCertInfoQuotaLimit'
 
@@ -719,6 +776,9 @@ INVALIDPARAMETERVALUE_CONFLICTRECORD = 'InvalidParameterValue.ConflictRecord'
 # DNS records conflict with DNSSEC.
 INVALIDPARAMETERVALUE_CONFLICTWITHDNSSEC = 'InvalidParameterValue.ConflictWithDNSSEC'
 
+# 
+INVALIDPARAMETERVALUE_CONFLICTWITHDOMAIN = 'InvalidParameterValue.ConflictWithDomain'
+
 # This DNS record conflicts with NS records.
 INVALIDPARAMETERVALUE_CONFLICTWITHNSRECORD = 'InvalidParameterValue.ConflictWithNSRecord'
 
@@ -758,6 +818,9 @@ INVALIDPARAMETERVALUE_INVALIDDOMAINNAME = 'InvalidParameterValue.InvalidDomainNa
 # Invalid domain name. Please check the status.
 INVALIDPARAMETERVALUE_INVALIDDOMAINSTATUS = 'InvalidParameterValue.InvalidDomainStatus'
 
+# Invalid keyless server ID.
+INVALIDPARAMETERVALUE_INVALIDKEYLESSSERVERID = 'InvalidParameterValue.InvalidKeylessServerId'
+
 # Incorrect DNS proxy
 INVALIDPARAMETERVALUE_INVALIDPROXYORIGIN = 'InvalidParameterValue.InvalidProxyOrigin'
 
@@ -785,10 +848,10 @@ INVALIDPARAMETERVALUE_PAGENAMEALREADYEXIST = 'InvalidParameterValue.PageNameAlre
 # Does not match the specified regular expression.
 INVALIDPARAMETERVALUE_REGEXMISMATCH = 'InvalidParameterValue.RegExMismatch'
 
-# 
+# Edge mTLS is enabled. When the client uses an RSA or ECC algorithm certificate, the same algorithm certificate should also be configured in the edge HTTPS certificate.
 INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINRSAORECC = 'InvalidParameterValue.ServerCertInfoNeedContainRSAorECC'
 
-# 
+# Edge mTLS is enabled. When the client uses a national encryption CA certificate, the national encryption certificate should also be configured in the edge HTTPS certificate.
 INVALIDPARAMETERVALUE_SERVERCERTINFONEEDCONTAINSM2 = 'InvalidParameterValue.ServerCertInfoNeedContainSM2'
 
 # Enter a valid shared CNAME prefix of up to 50 characters.
@@ -800,6 +863,9 @@ INVALIDPARAMETERVALUE_TOPLEVELDOMAINNOTSUPPORT = 'InvalidParameterValue.TopLevel
 # Configuration item error.
 INVALIDPARAMETERVALUE_UNRECOGNIZABLEVALUE = 'InvalidParameterValue.UnrecognizableValue'
 
+# 
+INVALIDPARAMETERVALUE_UPSTREAMCLIENTCERTINFOQUOTALIMIT = 'InvalidParameterValue.UpstreamClientCertInfoQuotaLimit'
+
 # The zone name format is incorrect. Please input a correctly formed domain name.
 INVALIDPARAMETERVALUE_ZONENAMEINVALID = 'InvalidParameterValue.ZoneNameInvalid'
 
@@ -827,6 +893,9 @@ LIMITEXCEEDED_DAILYQUOTA = 'LimitExceeded.DailyQuota'
 # The number of functions has reached the limit.
 LIMITEXCEEDED_FUNCTIONLIMITEXCEEDED = 'LimitExceeded.FunctionLimitExceeded'
 
+# The number of LoadBalancers exceeds the limit.
+LIMITEXCEEDED_LOADBALANCINGCOUNTLIMITEXCEEDED = 'LimitExceeded.LoadBalancingCountLimitExceeded'
+
 # Not supported by the plan.
 LIMITEXCEEDED_PACKNOTALLOW = 'LimitExceeded.PackNotAllow'
 
@@ -869,6 +938,9 @@ OPERATIONDENIED_ACCELERATEMAINLANDMULTIPLYLAYERCONFLICT = 'OperationDenied.Accel
 # An L7 DNS service referencing the origin group is being deployed. Please edit later.
 OPERATIONDENIED_ACCELERATIONDOMAINSTATUSNOTINONLINE = 'OperationDenied.AccelerationDomainStatusNotInOnline'
 
+# Currently, only the keyless certificate mode allows the private key of the certificate to be empty.
+OPERATIONDENIED_CERTIFICATEPRIVATEKEYISEMPTY = 'OperationDenied.CertificatePrivateKeyIsEmpty'
+
 # The current compliance status is banning.
 OPERATIONDENIED_COMPLIANCEFORBIDDEN = 'OperationDenied.ComplianceForbidden'
 
@@ -914,6 +986,15 @@ OPERATIONDENIED_ENVNOTREADY = 'OperationDenied.EnvNotReady'
 # The EdgeOne service of the site is disabled. Please enable it and try again.
 OPERATIONDENIED_ERRZONEISALREADYPAUSED = 'OperationDenied.ErrZoneIsAlreadyPaused'
 
+# 
+OPERATIONDENIED_HOSTSCLIENTCERTIFICATEINCONSISTENCY = 'OperationDenied.HostsClientCertificateInconsistency'
+
+# The keyless server of the domain name to be changed is inconsistent. Please confirm that the keyless server is consistent before retrying.
+OPERATIONDENIED_HOSTSKEYLESSSERVERINCONSISTENCY = 'OperationDenied.HostsKeylessServerInconsistency'
+
+# 
+OPERATIONDENIED_HOSTSUPSTREAMCERTIFICATEINCONSISTENCY = 'OperationDenied.HostsUpstreamCertificateInconsistency'
+
 # The security service must be enabled when you enable the DDoS Protection.
 OPERATIONDENIED_INVALIDADVANCEDDEFENSESECURITYTYPE = 'OperationDenied.InvalidAdvancedDefenseSecurityType'
 
@@ -926,6 +1007,12 @@ OPERATIONDENIED_IPV6ADVANCEDCONFLICT = 'OperationDenied.Ipv6AdvancedConflict'
 # The IPv6 feature and static IP cannot be enabled at the same time.
 OPERATIONDENIED_IPV6STATICIPCONFLICT = 'OperationDenied.Ipv6StaticIpConflict'
 
+# The domain name to be changed has a different certificate or keyless server. Please confirm that the edge HTTPS certificate or keyless server is consistent before retrying.
+OPERATIONDENIED_KEYLESSCERTSWITCHTOFREECERTCONFLICT = 'OperationDenied.KeylessCertSwitchToFreeCertConflict'
+
+# The keyless certificate mode requires the private key of the certificate to be empty.
+OPERATIONDENIED_KEYLESSMODECERTIFICATEPRIVATEKEYNEEDEMPTY = 'OperationDenied.KeylessModeCertificatePrivateKeyNeedEmpty'
+
 # The layer-4 instance resource sales are skyrocketing and now the resources are sold out. Replenishing is in progress. Currently, new layer-4 proxies cannot be added. Please wait.
 OPERATIONDENIED_L4LACKOFRESOURCES = 'OperationDenied.L4LackOfResources'
 
@@ -974,6 +1061,12 @@ OPERATIONDENIED_NODOMAINACCESSZONEONLYALLOWMODIFIEDTOCNAME = 'OperationDenied.No
 # You can only switch a site connected without a domain name to connecting via the CNAME. Other operations are not allowed.
 OPERATIONDENIED_NODOMAINACCESSZONEONLYSUPPORTMODIFYTYPE = 'OperationDenied.NoDomainAccessZoneOnlySupportModifyType'
 
+# Currently, the keyless certificate feature is available only to users in the allowlist.
+OPERATIONDENIED_NOTINKEYLESSWHITELIST = 'OperationDenied.NotInKeylessWhiteList'
+
+# 
+OPERATIONDENIED_NOTINUPSTREAMMTLSWHITELIST = 'OperationDenied.NotInUpstreamMTLSWhiteList'
+
 # The current user is not included in the whitelist for version management.
 OPERATIONDENIED_NOTINVERSIONCONTROLWHITELIST = 'OperationDenied.NotInVersionControlWhiteList'
 
@@ -1031,6 +1124,12 @@ OPERATIONDENIED_SHAREDCNAMEUNSUPPORTEDIPV6 = 'OperationDenied.SharedCNAMEUnsuppo
 # The static IP cannot be enabled for this instance's region.
 OPERATIONDENIED_STATICIPAREACONFLICT = 'OperationDenied.StaticIpAreaConflict'
 
+# 
+OPERATIONDENIED_UNSUPPORTTOCLOSEUPSTREAMMTLS = 'OperationDenied.UnSupportToCloseUpstreamMTLS'
+
+# 
+OPERATIONDENIED_USEUPSTREAMMTLSNEEDOPENHTTPS = 'OperationDenied.UseUpstreamMTLSNeedOpenHttps'
+
 # There is a test version in use. Please release the test version to the live environment, or roll back the test version and try again.
 OPERATIONDENIED_VERSIONCONTROLISGRAYING = 'OperationDenied.VersionControlIsGraying'