warframe-worldstate-data 1.23.4 → 1.23.7

package/data/tr/languages.json

@@ -12536,20 +12536,32 @@
     "value": "Two For One"
   },
   "/lotus/types/challenges/seasons/daily/seasondailybuilderstouch": {
-    "desc": "Builder's Touch",
-    "value": "Calim an item from your Foundry"
+    "desc": "Claim an item from your Foundry",
+    "value": "Builder's Touch"
   },
   "/lotus/types/challenges/seasons/daily/seasondailydeathfromabove": {
-    "desc": "Death from Above",
-    "value": "Kill 10 enemies with ground slams"
+    "desc": "Kill 10 enemies with ground slams",
+    "value": "Death from Above"
   },
   "/lotus/types/challenges/seasons/daily/seasondailyaugmentation": {
-    "desc": "Augmentation",
-    "value": "Install an Augment Mod on your Warframe"
+    "desc": "Install an Augment Mod on your Warframe",
+    "value": "Augmentation"
   },
   "/lotus/types/challenges/seasons/daily/seasondailytoppingoffthetank": {
-    "desc": "Topping Off the Tank",
-    "value": "Successfully defend an Excavator without allowing it to run out of power"
+    "desc": "Successfully defend an Excavator without allowing it to run out of power",
+    "value": "Topping Off the Tank"
+  },
+  "/lotus/types/challenges/seasons/daily/seasondailyliquidation": {
+    "desc": "Sell any item in your Inventory for Credits",
+    "value": "Liquidation"
+  },
+  "/lotus/types/challenges/seasons/daily/seasondailymediseasondailymedic": {
+    "desc": "Revive a fellow Tenno or a Companion",
+    "value": "Medic"
+  },
+  "/lotus/types/challenges/seasons/daily/seasondailyswatter": {
+    "desc": "Kill 3 Drones or Ospreys with your Melee Weapon",
+    "value": "Swatter"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklyboardingpartynodamage": {
     "desc": "Clear a Railjack Boarding Party without your Warframe taking damage",
@@ -12720,16 +12732,24 @@
     "value": "Venüs Ödül Avcısı"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklynightandday": {
-    "desc": "Night and Day",
-    "value": "Collect 15 Vome or Fass Residue in the Cambion Drift"
+    "desc": "Collect 15 Vome or Fass Residue in the Cambion Drift",
+    "value": "Night and Day"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklyloyalty": {
-    "desc": "Sadakat",
-    "value": "Gain a total of 5,000 Standing across all Syndicate factions"
+    "desc": "Gain a total of 5,000 Standing across all Syndicate factions",
+    "value": "Sadakat"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklymadlab": {
-    "desc": "Mad Lab",
-    "value": "Plunder one of Alad V's secret laboratories on Jupiter"
+    "desc": "Plunder one of Alad V's secret laboratories on Jupiter",
+    "value": "Mad Lab"
+  },
+  "/lotus/types/challenges/seasons/weekly/seasonweeklybloodthirsty": {
+    "desc": "Kill 20 enemies in 5 seconds",
+    "value": "Bloodthirsty"
+  },
+  "/lotus/types/challenges/seasons/weekly/seasonweeklytheoldways": {
+    "desc": "Complete 1 mission with only a single pistol and a glaive equipped",
+    "value": "The Old Ways"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardcollectuniqueresources": {
     "desc": "Collect 20 different types of resources.",
@@ -12784,7 +12804,7 @@
     "value": "Öldürücü Atış"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardkillenemiessteelpath": {
-    "desc": "Kill 100 Enemies on The Steel Path.",
+    "desc": "Kill 1,000 Enemies on The Steel Path.",
     "value": "Cold Steel"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardkilleximus": {
@@ -12840,8 +12860,8 @@
     "value": "Terminated"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardthepriceoffreedom": {
-    "desc": "The Price of Freedom",
-    "value": "Free one Captured Solaris using a Granum Crown"
+    "desc": "Free one Captured Solaris using a Granum Crown",
+    "value": "The Price of Freedom"
   },
   "/lotus/types/enemies/acolytes/areacasteracolyteagent": {
     "value": "Misery"

package/data/zh/languages.json

@@ -12536,20 +12536,32 @@
     "value": "Two For One"
   },
   "/lotus/types/challenges/seasons/daily/seasondailybuilderstouch": {
-    "desc": "Builder's Touch",
-    "value": "Calim an item from your Foundry"
+    "desc": "Claim an item from your Foundry",
+    "value": "Builder's Touch"
   },
   "/lotus/types/challenges/seasons/daily/seasondailydeathfromabove": {
-    "desc": "Death from Above",
-    "value": "Kill 10 enemies with ground slams"
+    "desc": "Kill 10 enemies with ground slams",
+    "value": "Death from Above"
   },
   "/lotus/types/challenges/seasons/daily/seasondailyaugmentation": {
-    "desc": "Augmentation",
-    "value": "Install an Augment Mod on your Warframe"
+    "desc": "Install an Augment Mod on your Warframe",
+    "value": "Augmentation"
   },
   "/lotus/types/challenges/seasons/daily/seasondailytoppingoffthetank": {
-    "desc": "Topping Off the Tank",
-    "value": "Successfully defend an Excavator without allowing it to run out of power"
+    "desc": "Successfully defend an Excavator without allowing it to run out of power",
+    "value": "Topping Off the Tank"
+  },
+  "/lotus/types/challenges/seasons/daily/seasondailyliquidation": {
+    "desc": "Sell any item in your Inventory for Credits",
+    "value": "Liquidation"
+  },
+  "/lotus/types/challenges/seasons/daily/seasondailymediseasondailymedic": {
+    "desc": "Revive a fellow Tenno or a Companion",
+    "value": "Medic"
+  },
+  "/lotus/types/challenges/seasons/daily/seasondailyswatter": {
+    "desc": "Kill 3 Drones or Ospreys with your Melee Weapon",
+    "value": "Swatter"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklyboardingpartynodamage": {
     "desc": "在 Warframe 没有受到伤害的情况下清除一批登上航道星舰的敌人",
@@ -12720,16 +12732,24 @@
     "value": "金星赏金猎人"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklynightandday": {
-    "desc": "Night and Day",
-    "value": "Collect 15 Vome or Fass Residue in the Cambion Drift"
+    "desc": "Collect 15 Vome or Fass Residue in the Cambion Drift",
+    "value": "Night and Day"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklyloyalty": {
-    "desc": "忠心不二",
-    "value": "Gain a total of 5,000 Standing across all Syndicate factions"
+    "desc": "Gain a total of 5,000 Standing across all Syndicate factions",
+    "value": "忠心不二"
   },
   "/lotus/types/challenges/seasons/weekly/seasonweeklymadlab": {
-    "desc": "Mad Lab",
-    "value": "Plunder one of Alad V's secret laboratories on Jupiter"
+    "desc": "Plunder one of Alad V's secret laboratories on Jupiter",
+    "value": "Mad Lab"
+  },
+  "/lotus/types/challenges/seasons/weekly/seasonweeklybloodthirsty": {
+    "desc": "Kill 20 enemies in 5 seconds",
+    "value": "Bloodthirsty"
+  },
+  "/lotus/types/challenges/seasons/weekly/seasonweeklytheoldways": {
+    "desc": "Complete 1 mission with only a single pistol and a glaive equipped",
+    "value": "The Old Ways"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardcollectuniqueresources": {
     "desc": "Collect 20 different types of resources.",
@@ -12784,7 +12804,7 @@
     "value": "杀戮"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardkillenemiessteelpath": {
-    "desc": "Kill 100 Enemies on The Steel Path.",
+    "desc": "Kill 1,000 Enemies on The Steel Path.",
     "value": "Cold Steel"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardkilleximus": {
@@ -12840,8 +12860,8 @@
     "value": "Terminated"
   },
   "/lotus/types/challenges/seasons/weeklyhard/seasonweeklyhardthepriceoffreedom": {
-    "desc": "The Price of Freedom",
-    "value": "Free one Captured Solaris using a Granum Crown"
+    "desc": "Free one Captured Solaris using a Granum Crown",
+    "value": "The Price of Freedom"
   },
   "/lotus/types/enemies/acolytes/areacasteracolyteagent": {
     "value": "苦难"

package/package.json

@@ -1,6 +1,6 @@
 {
   "name": "warframe-worldstate-data",
-  "version": "1.23.4",
+  "version": "1.23.7",
   "description": "Warframe data for use with warframe-worldstate-parser",
   "main": "exports.js",
   "directories": {
@@ -23,7 +23,7 @@
   "scripts": {
     "lint": "eslint --ignore-path .gitignore .",
     "lint:fix": "eslint --ignore-path .gitignore . --fix",
-    "test": " nyc mocha",
+    "test": "nyc mocha",
     "coverage": "npm test && nyc report --reporter=text-lcov | coveralls",
     "sort": "python tools/sort_languages.py",
     "validate": "npm run lint:fix && npm run test && git add -u ."
@@ -119,8 +119,6 @@
   },
   "mocha": {},
   "pre-commit": [
-    "lint",
-    "validate",
-    "test"
+    "validate"
   ]
 }