react-msaview 9.0.0 → 9.1.1

package/src/components/header/colorSchemeMenuItems.ts

@@ -0,0 +1,121 @@
+import type { MsaViewModel } from '../../model.ts'
+import type { MenuItem } from '@jbrowse/core/ui/Menu'
+
+type Alphabet = 'any' | 'nucleotide' | 'protein'
+
+interface SchemeEntry {
+  name: string
+  label: string
+  alphabet: Alphabet
+  // shown at the top level for its alphabet, the rest under More schemes
+  featured?: boolean
+}
+
+const schemes: SchemeEntry[] = [
+  { name: 'maeditor', label: 'MAEditor', alphabet: 'protein', featured: true },
+  {
+    name: 'clustalx_protein',
+    label: 'Clustal X',
+    alphabet: 'protein',
+    featured: true,
+  },
+  {
+    name: 'clustalx_protein_dynamic',
+    label: 'Clustal X, by column conservation',
+    alphabet: 'protein',
+    featured: true,
+  },
+  {
+    name: 'blosum62_dynamic',
+    label: 'BLOSUM62 similarity',
+    alphabet: 'protein',
+    featured: true,
+  },
+  {
+    name: 'jalview_hydrophobicity',
+    label: 'Hydrophobicity',
+    alphabet: 'protein',
+    featured: true,
+  },
+  {
+    name: 'nucleotide',
+    label: 'Nucleotide',
+    alphabet: 'nucleotide',
+    featured: true,
+  },
+  {
+    name: 'rainbow_dna',
+    label: 'Rainbow',
+    alphabet: 'nucleotide',
+    featured: true,
+  },
+  {
+    name: 'percent_identity_dynamic',
+    label: 'Percent identity',
+    alphabet: 'any',
+    featured: true,
+  },
+  { name: 'none', label: 'None', alphabet: 'any', featured: true },
+  { name: 'clustal', label: 'Clustal', alphabet: 'protein' },
+  { name: 'lesk', label: 'Lesk', alphabet: 'protein' },
+  { name: 'flower', label: 'Flower', alphabet: 'protein' },
+  { name: 'cinema', label: 'Cinema', alphabet: 'protein' },
+  { name: 'jalview_zappo', label: 'Zappo', alphabet: 'protein' },
+  { name: 'jalview_taylor', label: 'Taylor', alphabet: 'protein' },
+  { name: 'jalview_buried', label: 'Buried index', alphabet: 'protein' },
+  { name: 'jalview_prophelix', label: 'Helix propensity', alphabet: 'protein' },
+  {
+    name: 'jalview_propstrand',
+    label: 'Strand propensity',
+    alphabet: 'protein',
+  },
+  { name: 'jalview_propturn', label: 'Turn propensity', alphabet: 'protein' },
+  { name: 'clustalx_dna', label: 'Clustal X (DNA)', alphabet: 'nucleotide' },
+  { name: 'jbrowse_dna', label: 'JBrowse (DNA)', alphabet: 'nucleotide' },
+]
+
+export const catalogedSchemeNames = schemes.map(s => s.name)
+
+// While a `customColorScheme` map is set, a checked Custom entry stands for it
+// and no named scheme is checked. Picking a named scheme clears the map. The
+// active scheme always shows at the top level.
+export function colorSchemeMenuItems(model: MsaViewModel): MenuItem[] {
+  const { colorSchemeName, customColorScheme, sequenceType } = model
+  const alphabet = sequenceType === 'amino' ? 'protein' : 'nucleotide'
+  function radio(entry: SchemeEntry) {
+    return {
+      label: entry.label,
+      type: 'radio',
+      checked: !customColorScheme && colorSchemeName === entry.name,
+      onClick: () => {
+        model.setColorSchemeName(entry.name)
+        // a scheme picked while the domains fill the cells would color
+        // nothing, so the pick hands the cells back to the residues
+        if (model.cellFill === 'domain') {
+          model.setCellFill('residue')
+        }
+      },
+    } as const
+  }
+  const top = (e: SchemeEntry) =>
+    (e.featured && (e.alphabet === 'any' || e.alphabet === alphabet)) ||
+    (!customColorScheme && e.name === colorSchemeName)
+  return [
+    ...(customColorScheme
+      ? [
+          {
+            label: 'Custom',
+            type: 'radio',
+            checked: true,
+            onClick: () => {},
+          } as const,
+        ]
+      : []),
+    ...schemes.filter(top).map(radio),
+    {
+      label: 'More schemes',
+      type: 'subMenu',
+      subMenu: schemes.filter(e => !top(e)).map(radio),
+    },
+  ]
+}

package/src/components/header/getAnnotationsMenu.ts

@@ -1,80 +1,76 @@
 import { lazy } from 'react'
 
-import FilterAlt from '@mui/icons-material/FilterAlt'
-import FolderOpen from '@mui/icons-material/FolderOpen'
-import MenuBook from '@mui/icons-material/MenuBook'
-import Sort from '@mui/icons-material/Sort'
-import Visibility from '@mui/icons-material/Visibility'
-
 import type { MsaViewModel } from '../../model.ts'
+import type { MenuItem } from '@jbrowse/core/ui/Menu'
 
 const FeatureFilterDialog = lazy(() => import('../dialogs/FeatureDialog.tsx'))
 const AnnotationFileDialog = lazy(
   () => import('../dialogs/AnnotationFileDialog.tsx'),
 )
 
-const domainsTutorial = 'https://gmod.org/JBrowseMSA/tutorials/protein_family'
+export function openAnnotationFileItem(model: MsaViewModel): MenuItem {
+  return {
+    label: 'Open annotation file…',
+    onClick: () => {
+      model.queueDialog(handleClose => [
+        AnnotationFileDialog,
+        { handleClose, model },
+      ])
+    },
+  }
+}
 
-export function getAnnotationsMenu({ model }: { model: MsaViewModel }) {
-  const { showDomains, actuallyShowDomains, subFeatureRows, noDomains } = model
-  const noneLoaded = noDomains ? ' (none loaded)' : ''
+export function annotationsSubMenu(model: MsaViewModel): MenuItem[] {
+  const { showDomains, actuallyShowDomains, subFeatureRows } = model
   return [
     {
-      label: 'Open annotation file...',
-      icon: FolderOpen,
-      onClick: () => {
-        model.queueDialog(handleClose => [
-          AnnotationFileDialog,
-          {
-            handleClose,
-            model,
-          },
-        ])
-      },
-    },
-    // `react-msaview-cli interpro` reads InterPro's precomputed matches in
-    // seconds, and `interproscan` covers rows InterPro has not seen; this links
-    // the tutorial for both
-    {
-      label: 'How to get a domain file...',
-      icon: MenuBook,
-      onClick: () => {
-        window.open(domainsTutorial, '_blank', 'noopener,noreferrer')
-      },
-    },
-    {
-      label: `Show annotations${noneLoaded}`,
-      disabled: noDomains,
-      icon: Visibility,
+      label: 'Show annotations',
+      type: 'checkbox',
       checked: actuallyShowDomains,
-      type: 'checkbox' as const,
       onClick: () => {
         model.setShowDomains(!showDomains)
       },
     },
     {
-      label: `Use sub-row layout${noneLoaded}`,
-      disabled: noDomains,
-      checked: actuallyShowDomains ? subFeatureRows : false,
-      icon: Sort,
-      type: 'checkbox' as const,
+      label: 'Sub-row layout',
+      type: 'checkbox',
+      disabled: !actuallyShowDomains,
+      checked: actuallyShowDomains && subFeatureRows,
       onClick: () => {
         model.setSubFeatureRows(!subFeatureRows)
       },
     },
-    {
-      label: `Filter annotations${noneLoaded}`,
-      icon: FilterAlt,
-      disabled: noDomains,
-      onClick: () => {
-        model.queueDialog(onClose => [
-          FeatureFilterDialog,
-          {
-            onClose,
-            model,
-          },
-        ])
-      },
-    },
+    ...typeItems(model),
   ]
 }
+
+// up to this many types list inline, one checkbox each; past it the filter
+// dialog, which searches and counts them, takes over
+const inlineTypes = 12
+
+function typeItems(model: MsaViewModel): MenuItem[] {
+  const types = [...model.annotationTypes.values()]
+  return types.length <= inlineTypes
+    ? [
+        { type: 'subHeader', label: 'Types' },
+        ...types.map(({ accession, name }) => ({
+          label: name || accession,
+          type: 'checkbox' as const,
+          checked: !model.featureOff(accession),
+          onClick: () => {
+            model.setFilter(accession, model.featureOff(accession))
+          },
+        })),
+      ]
+    : [
+        {
+          label: 'Filter annotations…',
+          onClick: () => {
+            model.queueDialog(onClose => [
+              FeatureFilterDialog,
+              { onClose, model },
+            ])
+          },
+        },
+      ]
+}

package/src/components/header/menuBarItems.ts

@@ -0,0 +1,357 @@
+import { lazy } from 'react'
+
+import { maxNeighborJoiningRows, treeOrders } from '../../constants.ts'
+import { canGoTo } from '../dialogs/GoToBox.tsx'
+import { scrollZoomLabel } from './ScrollZoomCheckbox.tsx'
+import { colorSchemeMenuItems } from './colorSchemeMenuItems.ts'
+import { openAnnotationFileItem } from './getAnnotationsMenu.ts'
+
+import type { MsaViewModel } from '../../model.ts'
+import type { TreeOrder } from '../../types.ts'
+import type { ChoiceDisplay } from '../settings/MenuItemsForm.tsx'
+import type { MenuItem } from '@jbrowse/core/ui/Menu'
+
+const AboutDialog = lazy(() => import('../dialogs/AboutDialog.tsx'))
+const ExportSVGDialog = lazy(() => import('../dialogs/ExportSVGDialog.tsx'))
+const GapThresholdDialog = lazy(
+  () => import('../dialogs/GapThresholdDialog.tsx'),
+)
+const GoToDialog = lazy(() => import('../dialogs/GoToDialog.tsx'))
+const HelpDialog = lazy(() => import('../dialogs/HelpDialog.tsx'))
+const MetadataDialog = lazy(() => import('../dialogs/MetadataDialog.tsx'))
+
+const tutorialsUrl = 'https://gmod.org/JBrowseMSA/tutorials/'
+
+function radio(label: string, checked: boolean, onClick: () => void) {
+  return { label, type: 'radio' as const, checked, onClick }
+}
+
+function toggle(label: string, checked: boolean, set: (arg: boolean) => void) {
+  return {
+    label,
+    type: 'checkbox' as const,
+    checked,
+    onClick: () => {
+      set(!checked)
+    },
+  }
+}
+
+function action(label: string, onClick: () => void, disabled = false) {
+  return { label, onClick, disabled }
+}
+
+function subMenu(label: string, items: MenuItem[], display?: ChoiceDisplay) {
+  return { label, type: 'subMenu' as const, subMenu: items, display }
+}
+
+function when<T>(cond: boolean, items: T[]) {
+  return cond ? items : []
+}
+
+export function fileMenuItems(model: MsaViewModel): MenuItem[] {
+  return [
+    ...when(!!model.importForm, [
+      action('Open alignment…', () => {
+        model.reset()
+      }),
+    ]),
+    openAnnotationFileItem(model),
+    action('Export as SVG…', () => {
+      model.queueDialog(onClose => [ExportSVGDialog, { onClose, model }])
+    }),
+    ...when(!model.tree.noTree, [
+      action('Export tree as Newick', () => {
+        model.exportNewick()
+      }),
+    ]),
+    action('Alignment info…', () => {
+      model.queueDialog(onClose => [MetadataDialog, { model, onClose }])
+    }),
+  ]
+}
+
+function zoomSubMenu(model: MsaViewModel): MenuItem[] {
+  return [
+    action('Zoom in', () => {
+      model.zoomIn()
+    }),
+    action('Zoom out', () => {
+      model.zoomOut()
+    }),
+    action('Fit to window', () => {
+      model.fit()
+    }),
+    action('Fit width', () => {
+      model.fitHorizontally()
+    }),
+    action('Fit height', () => {
+      model.fitVertically()
+    }),
+    action('Reset zoom', () => {
+      model.resetZoom()
+    }),
+    toggle(scrollZoomLabel, model.scrollZoom, arg => {
+      model.setScrollZoom(arg)
+    }),
+  ]
+}
+
+const gapPresets = [100, 90, 50]
+
+export function gapsSubMenu(model: MsaViewModel): MenuItem[] {
+  const { hideGaps, allowedGappyness } = model
+  const custom = hideGaps && !gapPresets.includes(allowedGappyness)
+  return [
+    subMenu(
+      'Gappy columns',
+      [
+        radio('Show all columns', !hideGaps, () => {
+          model.setHideGaps(false)
+        }),
+        ...gapPresets.map(pct =>
+          radio(
+            pct === 100 ? 'Hide columns of only gaps' : `Hide ≥${pct}% gaps`,
+            hideGaps && allowedGappyness === pct,
+            () => {
+              model.setHideGaps(true)
+              model.setAllowedGappyness(pct)
+            },
+          ),
+        ),
+        {
+          ...radio(
+            custom ? `Hide ≥${allowedGappyness}% gaps…` : 'Custom threshold…',
+            custom,
+            () => {
+              model.setHideGaps(true)
+              model.queueDialog(onClose => [
+                GapThresholdDialog,
+                { model, onClose },
+              ])
+            },
+          ),
+          keepMenuOpen: false,
+        },
+      ],
+      'select',
+    ),
+  ]
+}
+
+const treeOrderLabels: Record<TreeOrder, string> = {
+  branchLength: 'By branch length',
+  input: 'Input order',
+  ladderize: 'Ladderize, small clades first',
+  ladderizeReverse: 'Ladderize, large clades first',
+}
+
+function outgroupLabel(outgroup: string[]) {
+  const [first, ...rest] = outgroup
+  return rest.length === 0
+    ? `Outgroup ${first}`
+    : `Outgroup ${first} … ${rest.at(-1)}`
+}
+
+export function treeSubMenu(model: MsaViewModel): MenuItem[] {
+  const {
+    drawTree,
+    showBranchLen,
+    labelsAlignRight,
+    drawNodeLabels,
+    drawLabels,
+    treeAreaWidth,
+    showTreeOverview,
+    showTreeScaleBar,
+    treeOrder,
+    treeRoot,
+    rotated,
+  } = model
+  return [
+    subMenu(
+      'Layout',
+      [
+        radio('Phylogram', drawTree && showBranchLen, () => {
+          model.setDrawTree(true)
+          model.setShowBranchLen(true)
+        }),
+        radio('Cladogram', drawTree && !showBranchLen, () => {
+          model.setDrawTree(true)
+          model.setShowBranchLen(false)
+        }),
+        radio('Labels only', !drawTree, () => {
+          model.setDrawTree(false)
+        }),
+      ],
+      'segmented',
+    ),
+    toggle('Tree overview', showTreeOverview, arg => {
+      model.setShowTreeOverview(arg)
+    }),
+    toggle('Scale bar', showTreeScaleBar, arg => {
+      model.setShowTreeScaleBar(arg)
+    }),
+    subMenu(
+      'Order',
+      [
+        ...treeOrders.map(order =>
+          radio(treeOrderLabels[order], treeOrder === order, () => {
+            model.setTreeOrder(order)
+          }),
+        ),
+        ...when(rotated.length > 0, [
+          action('Undo rotations', () => {
+            model.clearRotated()
+          }),
+        ]),
+      ],
+      'select',
+    ),
+    subMenu(
+      'Root',
+      [
+        radio('Input root', treeRoot === undefined, () => {
+          model.setTreeRoot(undefined)
+        }),
+        radio('Midpoint', treeRoot === 'midpoint', () => {
+          model.setTreeRoot('midpoint')
+        }),
+        // "Reroot here" in a node's menu sets the outgroup, so this only
+        // reports it
+        ...when(typeof treeRoot === 'object', [
+          {
+            ...radio(
+              typeof treeRoot === 'object'
+                ? outgroupLabel(treeRoot.outgroup)
+                : '',
+              true,
+              () => {},
+            ),
+            disabled: true,
+          },
+        ]),
+      ],
+      'select',
+    ),
+    subMenu('Labels', [
+      toggle('Tip labels', drawLabels, arg => {
+        model.setDrawLabels(arg)
+      }),
+      toggle('Internal node labels', drawNodeLabels, arg => {
+        model.setDrawNodeLabels(arg)
+      }),
+      toggle('Align right', labelsAlignRight, arg => {
+        model.setLabelsAlignRight(arg)
+      }),
+    ]),
+    ...when(treeAreaWidth !== undefined, [
+      action('Reset tree width', () => {
+        model.setTreeAreaWidth(undefined)
+      }),
+    ]),
+  ]
+}
+
+export function viewMenuItems(model: MsaViewModel): MenuItem[] {
+  return [
+    ...when(canGoTo(model), [
+      action('Find row or column…', () => {
+        model.queueDialog(onClose => [GoToDialog, { model, onClose }])
+      }),
+    ]),
+    subMenu('Zoom', zoomSubMenu(model)),
+  ]
+}
+
+export function trackSettingsItems(model: MsaViewModel): MenuItem[] {
+  return [
+    toggle('Show track values on hover', model.showColumnStats, arg => {
+      model.setShowColumnStats(arg)
+    }),
+  ]
+}
+
+// the settings panel's toggles for how the alignment draws
+export function alignmentSettingsItems(model: MsaViewModel): MenuItem[] {
+  return [
+    toggle('Show letters', model.drawMsaLetters, arg => {
+      model.setDrawMsaLetters(arg)
+    }),
+  ]
+}
+
+// who colors the cells comes first, since a scheme picked while the domains
+// fill them would otherwise change nothing on screen
+export function colorSettingsItems(model: MsaViewModel): MenuItem[] {
+  const { cellFill, filteredAnnotations } = model
+  return [
+    subMenu(
+      'Fill cells with',
+      [
+        radio('Residues', cellFill === 'residue', () => {
+          model.setCellFill('residue')
+        }),
+        ...when(filteredAnnotations.length > 0, [
+          radio('Domains', cellFill === 'domain', () => {
+            model.setShowDomains(true)
+            model.setCellFill('domain')
+          }),
+        ]),
+        {
+          ...radio('Nothing', cellFill === 'none', () => {
+            model.setCellFill('none')
+          }),
+          helpText: 'Color the letters instead',
+        },
+      ],
+      'segmented',
+    ),
+    {
+      type: 'subHeader',
+      label:
+        cellFill === 'domain'
+          ? 'Residue scheme: picking one takes the cells back from the domains'
+          : 'Residue scheme',
+    },
+    ...colorSchemeMenuItems(model),
+  ]
+}
+
+function neighborJoiningItem(model: MsaViewModel): MenuItem {
+  const rows = model.rowMap.size
+  const tooManyRows = rows > maxNeighborJoiningRows
+  return action(
+    tooManyRows
+      ? `Build neighbor joining tree (over ${maxNeighborJoiningRows} rows, use FastTree)`
+      : model.noTree
+        ? 'Build neighbor joining tree'
+        : 'Replace with neighbor joining tree',
+    () => {
+      try {
+        model.calculateNeighborJoiningTreeFromMSA()
+      } catch (e) {
+        console.error('Failed to calculate NJ tree:', e)
+        model.addWarning(e instanceof Error ? e.message : String(e))
+      }
+    },
+    tooManyRows || rows < 2,
+  )
+}
+
+export function toolsMenuItems(model: MsaViewModel): MenuItem[] {
+  return [neighborJoiningItem(model)]
+}
+
+export function helpMenuItems(model: MsaViewModel): MenuItem[] {
+  return [
+    action('Mouse & keyboard…', () => {
+      model.queueDialog(onClose => [HelpDialog, { model, onClose }])
+    }),
+    action('Tutorials', () => {
+      window.open(tutorialsUrl, '_blank', 'noopener,noreferrer')
+    }),
+    action('About & credits…', () => {
+      model.queueDialog(onClose => [AboutDialog, { onClose }])
+    }),
+  ]
+}

package/src/components/import/ImportForm.tsx

@@ -19,8 +19,8 @@ const ImportForm = observer(function ({ model }: { model: MsaViewModel }) {
   const { error } = model
 
   return (
-    <Container>
-      <Box sx={{ width: '50%', [phone]: { width: '100%' } }}>
+    <Container sx={{ pt: 2, pb: 3 }}>
+      <Box sx={{ width: '50%', mb: 2, [phone]: { width: '100%' } }}>
         {error ? <ErrorMessage error={error} /> : null}
         <Typography>
           Open an MSA file (FASTA, Stockholm, Clustal, A3M or EMF format) and/or
@@ -45,20 +45,32 @@ const ImportForm = observer(function ({ model }: { model: MsaViewModel }) {
           },
         }}
       >
-        <div>
+        <Box
+          sx={{
+            width: 400,
+            display: 'flex',
+            flexDirection: 'column',
+            gap: 1.5,
+            [phone]: { width: 'auto' },
+          }}
+        >
           <div>
             <Typography>MSA file or URL</Typography>
-            <FileSelector location={msaFile} setLocation={setMsaFile} />
+            <FileSelector inline location={msaFile} setLocation={setMsaFile} />
           </div>
           <div>
             <Typography>Tree file or URL</Typography>
-            <FileSelector location={treeFile} setLocation={setTreeFile} />
+            <FileSelector
+              inline
+              location={treeFile}
+              setLocation={setTreeFile}
+            />
           </div>
           <div>
             <Typography>Annotation GFF file or URL (optional)</Typography>
-            <FileSelector location={gffFile} setLocation={setGffFile} />
+            <FileSelector inline location={gffFile} setLocation={setGffFile} />
           </div>
-        </div>
+        </Box>
         <div>
           <Button
             onClick={() => {

package/src/components/import/data/seq2.ts

@@ -13,23 +13,5 @@ UniProt/Swiss-Prot|Q7JFM4|IL2_AOTVO        MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIG
 UniProt/Swiss-Prot|Q29416|IL2_CANFA        --------------LFLQLSLLG-------------------------------------
 `
 
-export const smallMSAOnly = `CLUSTAL O(1.2.4) multiple sequence alignment
-
-
-sp|P69905|HBA_HUMAN       MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG	60
-sp|P01942|HBA_MOUSE       MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG	60
-sp|P13786|HBAZ_CAPHI      MSLTRTERTIILSLWSKISTQADVIGTETLERLFSCYPQAKTYFPHFDLHSGSAQLRAHG	60
-                          * *:  ::: : : *.*:. :.   *:*:***:* .:* :********:  ****::.**
-
-sp|P69905|HBA_HUMAN       KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP	120
-sp|P01942|HBA_MOUSE       KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP	120
-sp|P13786|HBAZ_CAPHI      SKVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA	120
-                          .**. *: .*.  :*:: .*** **:***: *********:**********:* **:**
-
-sp|P69905|HBA_HUMAN       AVHASLDKFLASVSTVLTSKYR	142
-sp|P01942|HBA_MOUSE       AVHASLDKFLASVSTVLTSKYR	142
-sp|P13786|HBAZ_CAPHI      DAHAAWDKFLSIVSGVLTEKYR	142
-                           .**: ****: ** ***.***`
-
 export const smallTree =
   '(((UniProt/Swiss-Prot|P26898|IL2RA_SHEEP:0.24036,(UniProt/Swiss-Prot|P41690|IL2RA_FELCA:0.17737,(UniProt/Swiss-Prot|P01589|IL2RA_HUMAN:0.03906,UniProt/Swiss-Prot|Q5MNY4|IL2RA_MACMU:0.03787):0.13033):0.04964):0.02189,UniProt/Swiss-Prot|P01590|IL2RA_MOUSE:0.23072):0.06814,(((UniProt/Swiss-Prot|Q95118|IL2RG_BOVIN:0.09600,UniProt/Swiss-Prot|P40321|IL2RG_CANFA:0.09845):0.25333,UniProt/Swiss-Prot|Q29416|IL2_CANFA:-0.35055):0.10231,(UniProt/Swiss-Prot|P26896|IL2RB_RAT:0.33631,UniProt/Swiss-Prot|Q7JFM4|IL2_AOTVO:-0.33631):0.10166):0.01607,(UniProt/Swiss-Prot|Q8BZM1|GLMN_MOUSE:0.32378,UniProt/Swiss-Prot|P36835|IL2_CAPHI:-0.32378):0.09999)'