react-msaview 1.3.1 → 2.0.0

package/bundle/components/Track.js

@@ -1,81 +0,0 @@
-import React, { useState, useRef, useEffect } from 'react';
-import normalizeWheel from 'normalize-wheel';
-import { observer } from 'mobx-react';
-import { IconButton, Menu, MenuItem, makeStyles } from '@material-ui/core';
-import ArrowDropDownIcon from '@material-ui/icons/ArrowDropDown';
-import TrackInfoDialog from './TrackInfoDlg';
-var useStyles = makeStyles(function () { return ({
-    button: {
-        padding: 0,
-    },
-}); });
-export var TrackLabel = observer(function (_a) {
-    var model = _a.model, track = _a.track;
-    var _b = useState(), anchorEl = _b[0], setAnchorEl = _b[1];
-    var _c = useState(false), trackInfoDlgOpen = _c[0], setTrackInfoDlgOpen = _c[1];
-    var rowHeight = model.rowHeight, width = model.treeAreaWidth;
-    var height = track.height, name = track.model.name;
-    var classes = useStyles();
-    var trackLabelHeight = Math.max(8, rowHeight - 8);
-    return (React.createElement("div", { style: {
-            width: width,
-            height: height,
-            flexShrink: 0,
-            textAlign: 'right',
-            fontSize: trackLabelHeight,
-        } },
-        name,
-        React.createElement(IconButton, { className: classes.button, style: { width: trackLabelHeight, height: trackLabelHeight }, onClick: function (event) {
-                setAnchorEl(event.target);
-            } },
-            React.createElement(ArrowDropDownIcon, null)),
-        anchorEl ? (React.createElement(Menu, { anchorEl: anchorEl, transitionDuration: 0, open: true, onClose: function () {
-                setAnchorEl(undefined);
-            } },
-            React.createElement(MenuItem, { dense: true, onClick: function () {
-                    model.toggleTrack(track.model.id);
-                    setAnchorEl(undefined);
-                } }, "Close"),
-            React.createElement(MenuItem, { dense: true, onClick: function () {
-                    setTrackInfoDlgOpen(true);
-                    setAnchorEl(undefined);
-                } }, "Get info"))) : null,
-        trackInfoDlgOpen ? (React.createElement(TrackInfoDialog, { model: track.model, onClose: function () { return setTrackInfoDlgOpen(false); } })) : null));
-});
-var Track = observer(function (_a) {
-    var model = _a.model, track = _a.track;
-    var resizeHandleWidth = model.resizeHandleWidth;
-    var height = track.model.height;
-    var ref = useRef(null);
-    var scheduled = useRef(false);
-    var deltaX = useRef(0);
-    useEffect(function () {
-        var curr = ref.current;
-        if (!curr) {
-            return;
-        }
-        function onWheel(origEvent) {
-            var event = normalizeWheel(origEvent);
-            deltaX.current += event.pixelX;
-            if (!scheduled.current) {
-                scheduled.current = true;
-                requestAnimationFrame(function () {
-                    model.doScrollX(-deltaX.current);
-                    deltaX.current = 0;
-                    scheduled.current = false;
-                });
-            }
-            origEvent.preventDefault();
-        }
-        curr.addEventListener('wheel', onWheel);
-        return function () {
-            curr.removeEventListener('wheel', onWheel);
-        };
-    }, [model]);
-    return (React.createElement("div", { key: track.id, style: { display: 'flex', height: height } },
-        React.createElement(TrackLabel, { model: model, track: track }),
-        React.createElement("div", { style: { width: resizeHandleWidth, flexShrink: 0 } }),
-        React.createElement("div", { ref: ref },
-            React.createElement(track.ReactComponent, { model: model, track: track }))));
-});
-export default Track;

package/bundle/components/TrackInfoDlg.d.ts

@@ -1,6 +0,0 @@
-/// <reference types="react" />
-declare const TrackInfoDialog: ({ model, onClose }: {
-    model: any;
-    onClose: () => void;
-}) => JSX.Element;
-export default TrackInfoDialog;

package/bundle/components/TrackInfoDlg.js

@@ -1,33 +0,0 @@
-import React, { useState } from 'react';
-import copy from 'copy-to-clipboard';
-import { observer } from 'mobx-react';
-import { Button, Dialog, DialogActions, DialogTitle, DialogContent, makeStyles, } from '@material-ui/core';
-var useStyles = makeStyles(function (theme) { return ({
-    textArea: {
-        padding: theme.spacing(2),
-        overflow: 'auto',
-        background: '#ddd',
-        wordBreak: 'break-word',
-    },
-}); });
-var TrackInfoDialog = observer(function (_a) {
-    var model = _a.model, onClose = _a.onClose;
-    var _b = useState('Copy to clipboard'), label = _b[0], setLabel = _b[1];
-    var classes = useStyles();
-    return (React.createElement(Dialog, { open: true, onClose: onClose, fullWidth: true, maxWidth: "lg" },
-        React.createElement(DialogTitle, null,
-            "Track info - ",
-            model.name),
-        React.createElement(DialogContent, null,
-            React.createElement(Button, { variant: "contained", color: "primary", onClick: function () {
-                    copy(model.data);
-                    setLabel('Copied!');
-                    setTimeout(function () {
-                        setLabel('Copy to clipboard');
-                    }, 300);
-                } }, label),
-            React.createElement("pre", { className: classes.textArea }, model.data)),
-        React.createElement(DialogActions, null,
-            React.createElement(Button, { variant: "contained", onClick: onClose, color: "secondary" }, "Close"))));
-});
-export default TrackInfoDialog;

package/bundle/components/TracklistDlg.d.ts

@@ -1,8 +0,0 @@
-/// <reference types="react" />
-import { MsaViewModel } from '../model';
-declare const _default: ({ model, onClose, open, }: {
-    model: MsaViewModel;
-    onClose: () => void;
-    open: boolean;
-}) => JSX.Element;
-export default _default;

package/bundle/components/TracklistDlg.js

@@ -1,18 +0,0 @@
-import React from 'react';
-import { Dialog, DialogTitle, DialogContent, FormControlLabel, FormGroup, Checkbox, DialogActions, Button, Typography, } from '@material-ui/core';
-import { observer } from 'mobx-react';
-export default observer(function (_a) {
-    var model = _a.model, onClose = _a.onClose, open = _a.open;
-    var tracks = model.tracks;
-    return (React.createElement(Dialog, { onClose: function () { return onClose(); }, open: open },
-        React.createElement(DialogTitle, null, "Add track"),
-        React.createElement(DialogContent, null,
-            React.createElement(Typography, null, "Open relevant per-alignment tracks e.g. protein domains"),
-            React.createElement(FormGroup, null, tracks.map(function (track) {
-                return (React.createElement(FormControlLabel, { key: track.model.id, control: React.createElement(Checkbox, { checked: !model.turnedOffTracks.has(track.model.id), onChange: function () {
-                            model.toggleTrack(track.model.id);
-                        } }), label: track.model.name }));
-            })),
-            React.createElement(DialogActions, null,
-                React.createElement(Button, { onClick: function () { return onClose(); }, variant: "contained", color: "primary" }, "Close")))));
-});

package/bundle/components/TreeCanvas.d.ts

@@ -1,6 +0,0 @@
-/// <reference types="react" />
-import { MsaViewModel } from '../model';
-declare const TreeCanvas: ({ model }: {
-    model: MsaViewModel;
-}) => JSX.Element;
-export default TreeCanvas;

package/bundle/components/TreeCanvas.js

@@ -1,431 +0,0 @@
-var __assign = (this && this.__assign) || function () {
-    __assign = Object.assign || function(t) {
-        for (var s, i = 1, n = arguments.length; i < n; i++) {
-            s = arguments[i];
-            for (var p in s) if (Object.prototype.hasOwnProperty.call(s, p))
-                t[p] = s[p];
-        }
-        return t;
-    };
-    return __assign.apply(this, arguments);
-};
-import React, { useEffect, useRef, useState } from 'react';
-import { Menu, MenuItem } from '@material-ui/core';
-import normalizeWheel from 'normalize-wheel';
-import { observer } from 'mobx-react';
-import RBush from 'rbush';
-import MoreInfoDlg from './MoreInfoDlg';
-var extendBounds = 5;
-var radius = 3.5;
-var d = radius * 2;
-var padding = 600;
-var TreeMenu = observer(function (_a) {
-    var _b, _c;
-    var node = _a.node, onClose = _a.onClose, model = _a.model;
-    var structures = model.structures;
-    var nodeDetails = node ? model.getRowDetails(node.name) : undefined;
-    return (React.createElement(React.Fragment, null,
-        React.createElement(Menu, { anchorReference: "anchorPosition", anchorPosition: {
-                top: node.y,
-                left: node.x,
-            }, transitionDuration: 0, keepMounted: true, open: Boolean(node), onClose: onClose },
-            React.createElement(MenuItem, { dense: true, disabled: true }, node.name),
-            React.createElement(MenuItem, { dense: true, onClick: function () {
-                    model.setDialogComponent(MoreInfoDlg, {
-                        info: model.getRowDetails(node.name),
-                    });
-                    onClose();
-                } }, "More info..."), (_b = structures[node.name]) === null || _b === void 0 ? void 0 :
-            _b.map(function (entry) {
-                return !model.selectedStructures.find(function (n) { return n.id === node.name; }) ? (React.createElement(MenuItem, { key: JSON.stringify(entry), dense: true, onClick: function () {
-                        model.addStructureToSelection({
-                            structure: entry,
-                            id: node.name,
-                        });
-                        onClose();
-                    } },
-                    "Add PDB to selection (",
-                    entry.pdb,
-                    ")")) : (React.createElement(MenuItem, { key: JSON.stringify(entry), dense: true, onClick: function () {
-                        model.removeStructureFromSelection({
-                            structure: entry,
-                            id: node.name,
-                        });
-                        onClose();
-                    } },
-                    "Remove PDB from selection (",
-                    entry.pdb,
-                    ")"));
-            }), (_c = nodeDetails.accession) === null || _c === void 0 ? void 0 :
-            _c.map(function (accession) { return (React.createElement(MenuItem, { dense: true, key: accession, onClick: function () {
-                    model.addUniprotTrack({ name: nodeDetails.name, accession: accession });
-                    onClose();
-                } },
-                "Open UniProt track (",
-                accession,
-                ")")); }))));
-});
-var TreeBranchMenu = observer(function (_a) {
-    var node = _a.node, model = _a.model, onClose = _a.onClose;
-    return (React.createElement(Menu, { anchorReference: "anchorPosition", anchorPosition: {
-            left: node.x,
-            top: node.y,
-        }, transitionDuration: 0, keepMounted: true, open: Boolean(node), onClose: onClose },
-        React.createElement(MenuItem, { dense: true, disabled: true }, node.name),
-        React.createElement(MenuItem, { dense: true, onClick: function () {
-                model.toggleCollapsed(node.id);
-                onClose();
-            } }, model.collapsed.includes(node.id)
-            ? 'Expand this node'
-            : 'Collapse this node'),
-        React.createElement(MenuItem, { dense: true, onClick: function () {
-                model.showOnly === node.id
-                    ? model.setShowOnly(undefined)
-                    : model.setShowOnly(node.id);
-                onClose();
-            } }, model.showOnly === node.id
-            ? 'Disable show only this node'
-            : 'Show only this node')));
-});
-var TreeBlock = observer(function (_a) {
-    var model = _a.model, offsetY = _a.offsetY;
-    var ref = useRef(null);
-    var clickMap = useRef(new RBush());
-    var mouseoverRef = useRef(null);
-    var _b = useState(), branchMenu = _b[0], setBranchMenu = _b[1];
-    var _c = useState(), toggleNodeMenu = _c[0], setToggleNodeMenu = _c[1];
-    var _d = useState(), hoverElt = _d[0], setHoverElt = _d[1];
-    var hierarchy = model.hierarchy, rowHeight = model.rowHeight, scrollY = model.scrollY, treeWidth = model.treeWidth, showBranchLen = model.showBranchLen, collapsed = model.collapsed, margin = model.margin, labelsAlignRight = model.labelsAlignRight, noTree = model.noTree, blockSize = model.blockSize, drawNodeBubbles = model.drawNodeBubbles, drawTree = model.drawTree, treeAreaWidth = model.treeAreaWidth, structures = model.structures, highResScaleFactor = model.highResScaleFactor;
-    useEffect(function () {
-        clickMap.current.clear();
-        if (!ref.current) {
-            return;
-        }
-        var ctx = ref.current.getContext('2d');
-        if (!ctx) {
-            return;
-        }
-        ctx.resetTransform();
-        ctx.scale(highResScaleFactor, highResScaleFactor);
-        ctx.clearRect(0, 0, treeWidth + padding, blockSize);
-        ctx.translate(margin.left, -offsetY);
-        var font = ctx.font;
-        ctx.font = font.replace(/\d+px/, Math.max(8, rowHeight - 8) + "px");
-        if (!noTree && drawTree) {
-            hierarchy.links().forEach(function (_a) {
-                var source = _a.source, target = _a.target;
-                var y = showBranchLen ? 'len' : 'y';
-                //@ts-ignore
-                var _b = source, sy = _b.x, _c = y, sx = _b[_c];
-                //@ts-ignore
-                var _d = target, ty = _d.x, _e = y, tx = _d[_e];
-                var y1 = Math.min(sy, ty);
-                var y2 = Math.max(sy, ty);
-                //1d line intersection to check if line crosses block at all, this is
-                //an optimization that allows us to skip drawing most tree links
-                //outside the block
-                if (offsetY + blockSize >= y1 && y2 >= offsetY) {
-                    ctx.beginPath();
-                    ctx.moveTo(sx, sy);
-                    ctx.lineTo(sx, ty);
-                    ctx.lineTo(tx, ty);
-                    ctx.stroke();
-                }
-            });
-            if (drawNodeBubbles) {
-                hierarchy.descendants().forEach(function (node) {
-                    var val = showBranchLen ? 'len' : 'y';
-                    var _a = node, 
-                    //@ts-ignore
-                    y = _a.x, 
-                    //@ts-ignore
-                    _b = val, 
-                    //@ts-ignore
-                    x = _a[_b], data = _a.data;
-                    var _c = data.id, id = _c === void 0 ? '' : _c, _d = data.name, name = _d === void 0 ? '' : _d;
-                    if (y > offsetY - extendBounds &&
-                        y < offsetY + blockSize + extendBounds) {
-                        ctx.strokeStyle = 'black';
-                        ctx.fillStyle = collapsed.includes(id) ? 'black' : 'white';
-                        ctx.beginPath();
-                        ctx.arc(x, y, radius, 0, 2 * Math.PI);
-                        ctx.fill();
-                        ctx.stroke();
-                        clickMap.current.insert({
-                            minX: x - radius,
-                            maxX: x - radius + d,
-                            minY: y - radius,
-                            maxY: y - radius + d,
-                            branch: true,
-                            id: id,
-                            name: name,
-                        });
-                    }
-                });
-            }
-        }
-        if (rowHeight >= 10) {
-            if (labelsAlignRight) {
-                ctx.textAlign = 'right';
-                ctx.setLineDash([1, 3]);
-            }
-            else {
-                ctx.textAlign = 'start';
-            }
-            hierarchy.leaves().forEach(function (node) {
-                var 
-                //@ts-ignore
-                y = node.x, 
-                //@ts-ignore
-                x = node.y, _a = node.data, name = _a.name, id = _a.id, 
-                //@ts-ignore
-                len = node.len;
-                if (y > offsetY - extendBounds &&
-                    y < offsetY + blockSize + extendBounds) {
-                    //note: +rowHeight/4 matches with -rowHeight/4 in msa
-                    var yp = y + rowHeight / 4;
-                    var xp = showBranchLen ? len : x;
-                    var width = ctx.measureText(name).width;
-                    var height = ctx.measureText('M').width; // use an 'em' for height
-                    var hasStructure = structures[name];
-                    ctx.fillStyle = hasStructure ? 'blue' : 'black';
-                    if (!drawTree && !labelsAlignRight) {
-                        ctx.fillText(name, 0, yp);
-                        clickMap.current.insert({
-                            minX: 0,
-                            maxX: width,
-                            minY: yp - height,
-                            maxY: yp,
-                            name: name,
-                            id: id,
-                        });
-                    }
-                    else if (labelsAlignRight) {
-                        var smallPadding = 2;
-                        var offset = treeAreaWidth - smallPadding - margin.left;
-                        if (drawTree && !noTree) {
-                            var width_1 = ctx.measureText(name).width;
-                            ctx.moveTo(xp + radius + 2, y);
-                            ctx.lineTo(offset - smallPadding - width_1, y);
-                            ctx.stroke();
-                        }
-                        ctx.fillText(name, offset, yp);
-                        clickMap.current.insert({
-                            minX: treeAreaWidth - margin.left - width,
-                            maxX: treeAreaWidth - margin.left,
-                            minY: yp - height,
-                            maxY: yp,
-                            name: name,
-                            id: id,
-                        });
-                    }
-                    else {
-                        ctx.fillText(name, xp + d, yp);
-                        clickMap.current.insert({
-                            minX: xp + d,
-                            maxX: xp + d + width,
-                            minY: yp - height,
-                            maxY: yp,
-                            name: name,
-                            id: id,
-                        });
-                    }
-                }
-            });
-            ctx.setLineDash([]);
-        }
-    }, [
-        collapsed,
-        rowHeight,
-        margin.left,
-        hierarchy,
-        offsetY,
-        treeWidth,
-        showBranchLen,
-        noTree,
-        blockSize,
-        drawNodeBubbles,
-        drawTree,
-        labelsAlignRight,
-        treeAreaWidth,
-        structures,
-    ]);
-    useEffect(function () {
-        var canvas = mouseoverRef.current;
-        if (!canvas) {
-            return;
-        }
-        var ctx = canvas.getContext('2d');
-        if (!ctx) {
-            return;
-        }
-        ctx.resetTransform();
-        ctx.clearRect(0, 0, treeWidth + padding, blockSize);
-        ctx.translate(margin.left, -offsetY);
-        if (hoverElt) {
-            var minX = hoverElt.minX, maxX = hoverElt.maxX, minY = hoverElt.minY, maxY = hoverElt.maxY;
-            ctx.fillStyle = 'rgba(0,0,0,0.1)';
-            ctx.fillRect(minX, minY, maxX - minX, maxY - minY);
-        }
-    }, [hoverElt, margin.left, offsetY, blockSize, treeWidth]);
-    function hoverBranchClickMap(event) {
-        var x = event.nativeEvent.offsetX - margin.left;
-        var y = event.nativeEvent.offsetY;
-        var entry = clickMap.current.search({
-            minX: x,
-            maxX: x + 1,
-            minY: y + offsetY,
-            maxY: y + 1 + offsetY,
-        })[0];
-        return entry && entry.branch
-            ? __assign(__assign({}, entry), { x: event.clientX, y: event.clientY }) : undefined;
-    }
-    function hoverNameClickMap(event) {
-        var x = event.nativeEvent.offsetX - margin.left;
-        var y = event.nativeEvent.offsetY;
-        var entry = clickMap.current.search({
-            minX: x,
-            maxX: x + 1,
-            minY: y + offsetY,
-            maxY: y + 1 + offsetY,
-        })[0];
-        return entry && !entry.branch
-            ? __assign(__assign({}, entry), { x: event.clientX, y: event.clientY }) : undefined;
-    }
-    return (React.createElement(React.Fragment, null,
-        (branchMenu === null || branchMenu === void 0 ? void 0 : branchMenu.id) ? (React.createElement(TreeBranchMenu, { node: branchMenu, model: model, onClose: function () { return setBranchMenu(undefined); } })) : null,
-        (toggleNodeMenu === null || toggleNodeMenu === void 0 ? void 0 : toggleNodeMenu.id) ? (React.createElement(TreeMenu, { node: toggleNodeMenu, model: model, onClose: function () { return setToggleNodeMenu(undefined); } })) : null,
-        React.createElement("canvas", { width: (treeWidth + padding) * highResScaleFactor, height: blockSize * highResScaleFactor, style: {
-                width: treeWidth + padding,
-                height: blockSize,
-                top: scrollY + offsetY,
-                left: 0,
-                position: 'absolute',
-            }, onMouseMove: function (event) {
-                if (!ref.current) {
-                    return;
-                }
-                var ret = hoverNameClickMap(event) || hoverBranchClickMap(event);
-                if (ret) {
-                    ref.current.style.cursor = 'pointer';
-                }
-                else {
-                    ref.current.style.cursor = 'default';
-                }
-                setHoverElt(hoverNameClickMap(event));
-            }, onClick: function (event) {
-                var x = event.clientX, y = event.clientY;
-                var data = hoverBranchClickMap(event);
-                if (data === null || data === void 0 ? void 0 : data.id) {
-                    setBranchMenu(__assign(__assign({}, data), { x: x, y: y }));
-                }
-                var data2 = hoverNameClickMap(event);
-                if (data2 === null || data2 === void 0 ? void 0 : data2.id) {
-                    setToggleNodeMenu(__assign(__assign({}, data2), { x: x, y: y }));
-                }
-            }, ref: ref }),
-        React.createElement("canvas", { style: {
-                width: treeWidth + padding,
-                height: blockSize,
-                top: scrollY + offsetY,
-                left: 0,
-                position: 'absolute',
-                pointerEvents: 'none',
-                zIndex: 100,
-            }, width: treeWidth + padding, height: blockSize, ref: mouseoverRef })));
-});
-var TreeCanvas = observer(function (_a) {
-    var model = _a.model;
-    var ref = useRef(null);
-    var scheduled = useRef(false);
-    var deltaY = useRef(0);
-    var prevY = useRef(0);
-    var treeWidth = model.treeWidth, height = model.height, blocksY = model.blocksY;
-    var _b = useState(false), mouseDragging = _b[0], setMouseDragging = _b[1];
-    useEffect(function () {
-        var curr = ref.current;
-        if (!curr) {
-            return;
-        }
-        function onWheel(origEvent) {
-            var event = normalizeWheel(origEvent);
-            deltaY.current += event.pixelY;
-            if (!scheduled.current) {
-                scheduled.current = true;
-                requestAnimationFrame(function () {
-                    model.doScrollY(-deltaY.current);
-                    deltaY.current = 0;
-                    scheduled.current = false;
-                });
-            }
-            origEvent.preventDefault();
-        }
-        curr.addEventListener('wheel', onWheel);
-        return function () {
-            curr.removeEventListener('wheel', onWheel);
-        };
-    }, [model]);
-    useEffect(function () {
-        var cleanup = function () { };
-        function globalMouseMove(event) {
-            event.preventDefault();
-            var currY = event.clientY;
-            var distanceY = currY - prevY.current;
-            if (distanceY) {
-                // use rAF to make it so multiple event handlers aren't fired per-frame
-                // see https://calendar.perfplanet.com/2013/the-runtime-performance-checklist/
-                if (!scheduled.current) {
-                    scheduled.current = true;
-                    window.requestAnimationFrame(function () {
-                        model.doScrollY(distanceY);
-                        scheduled.current = false;
-                        prevY.current = event.clientY;
-                    });
-                }
-            }
-        }
-        function globalMouseUp() {
-            prevY.current = 0;
-            if (mouseDragging) {
-                setMouseDragging(false);
-            }
-        }
-        if (mouseDragging) {
-            window.addEventListener('mousemove', globalMouseMove, true);
-            window.addEventListener('mouseup', globalMouseUp, true);
-            cleanup = function () {
-                window.removeEventListener('mousemove', globalMouseMove, true);
-                window.removeEventListener('mouseup', globalMouseUp, true);
-            };
-        }
-        return cleanup;
-    }, [model, mouseDragging]);
-    function mouseDown(event) {
-        // check if clicking a draggable element or a resize handle
-        var target = event.target;
-        if (target.draggable || target.dataset.resizer) {
-            return;
-        }
-        // otherwise do click and drag scroll
-        if (event.button === 0) {
-            prevY.current = event.clientY;
-            setMouseDragging(true);
-        }
-    }
-    // this local mouseup is used in addition to the global because sometimes
-    // the global add/remove are not called in time, resulting in issue #533
-    function mouseUp(event) {
-        event.preventDefault();
-        setMouseDragging(false);
-    }
-    function mouseLeave(event) {
-        event.preventDefault();
-    }
-    return (React.createElement("div", { ref: ref, onMouseDown: mouseDown, onMouseUp: mouseUp, onMouseLeave: mouseLeave, style: {
-            height: height,
-            position: 'relative',
-            overflow: 'hidden',
-            width: treeWidth + padding,
-        } }, blocksY.map(function (block) { return (React.createElement(TreeBlock, { key: block, model: model, offsetY: block })); })));
-});
-export default TreeCanvas;

package/bundle/components/TreeRuler.d.ts

@@ -1,6 +0,0 @@
-/// <reference types="react" />
-import { MsaViewModel } from '../model';
-declare const TreeRuler: ({ model }: {
-    model: MsaViewModel;
-}) => JSX.Element;
-export default TreeRuler;

package/bundle/components/TreeRuler.js

@@ -1,8 +0,0 @@
-import React from 'react';
-import { observer } from 'mobx-react';
-var TreeRuler = observer(function (_a) {
-    var model = _a.model;
-    var treeWidth = model.treeWidth;
-    return React.createElement("div", { style: { width: treeWidth } });
-});
-export default TreeRuler;

package/bundle/components/data/seq2.d.ts

@@ -1,3 +0,0 @@
-export const smallMSA: "CLUSTAL O(1.2.3) multiple sequence alignment\nUniProt/Swiss-Prot|P26898|IL2RA_SHEEP      MEPSLLMWRFFVFIVVPGCVTEACHDDPPSLRNA----------MFKVLRYE----VGTM\nUniProt/Swiss-Prot|P01590|IL2RA_MOUSE      MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNA----------TFKALSYK----NGTI\nUniProt/Swiss-Prot|P41690|IL2RA_FELCA      MEPSLLLWGILTFVVVHGHVTELCDENPPDIQHA----------TFKALTYK----TGTM\nUniProt/Swiss-Prot|P01589|IL2RA_HUMAN      MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHA----------TFKAMAYK----EGTM\nUniProt/Swiss-Prot|Q5MNY4|IL2RA_MACMU      MDPYLLMWGLLTFITVPGCQAELCDDDPPKITHA----------TFKAVAYK----EGTM\nUniProt/Swiss-Prot|Q95118|IL2RG_BOVIN      -----------------------------------LLMWGLLT-----------------\nUniProt/Swiss-Prot|P40321|IL2RG_CANFA      MLKPPLPLRSLLFLQLSLLGVGLNSTVPMPNGNEDIT------PDFFLTATPSETLSVSS\nUniProt/Swiss-Prot|P26896|IL2RB_RAT        MATVDLSWRLPLYILLLLLATT--------------------------------WVSAAV\nUniProt/Swiss-Prot|Q8BZM1|GLMN_MOUSE       PLPLRSLLFLQLPLLGVGLNP------------------PLPLRSLLFLQLPLLGVGLNP\nUniProt/Swiss-Prot|P36835|IL2_CAPHI        -----------LLGVGLNPKFLTP------------------------------------\nUniProt/Swiss-Prot|Q7JFM4|IL2_AOTVO        MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIGGKPGTGGDFFLTSTPAGTLDVST\nUniProt/Swiss-Prot|Q29416|IL2_CANFA        --------------LFLQLSLLG-------------------------------------\n";
-export const smallMSAOnly: "CLUSTAL O(1.2.4) multiple sequence alignment\n\n\nsp|P69905|HBA_HUMAN       MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG\t60\nsp|P01942|HBA_MOUSE       MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG\t60\nsp|P13786|HBAZ_CAPHI      MSLTRTERTIILSLWSKISTQADVIGTETLERLFSCYPQAKTYFPHFDLHSGSAQLRAHG\t60\n                          * *:  ::: : : *.*:. :.   *:*:***:* .:* :********:  ****::.**\n\nsp|P69905|HBA_HUMAN       KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP\t120\nsp|P01942|HBA_MOUSE       KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP\t120\nsp|P13786|HBAZ_CAPHI      SKVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA\t120\n                          .**. *: .*.  :*:: .*** **:***: *********:**********:* **:**\n\nsp|P69905|HBA_HUMAN       AVHASLDKFLASVSTVLTSKYR\t142\nsp|P01942|HBA_MOUSE       AVHASLDKFLASVSTVLTSKYR\t142\nsp|P13786|HBAZ_CAPHI      DAHAAWDKFLSIVSGVLTEKYR\t142\n                           .**: ****: ** ***.***";
-export const smallTree: "(((UniProt/Swiss-Prot|P26898|IL2RA_SHEEP:0.24036,(UniProt/Swiss-Prot|P41690|IL2RA_FELCA:0.17737,(UniProt/Swiss-Prot|P01589|IL2RA_HUMAN:0.03906,UniProt/Swiss-Prot|Q5MNY4|IL2RA_MACMU:0.03787):0.13033):0.04964):0.02189,UniProt/Swiss-Prot|P01590|IL2RA_MOUSE:0.23072):0.06814,(((UniProt/Swiss-Prot|Q95118|IL2RG_BOVIN:0.09600,UniProt/Swiss-Prot|P40321|IL2RG_CANFA:0.09845):0.25333,UniProt/Swiss-Prot|Q29416|IL2_CANFA:-0.35055):0.10231,(UniProt/Swiss-Prot|P26896|IL2RB_RAT:0.33631,UniProt/Swiss-Prot|Q7JFM4|IL2_AOTVO:-0.33631):0.10166):0.01607,(UniProt/Swiss-Prot|Q8BZM1|GLMN_MOUSE:0.32378,UniProt/Swiss-Prot|P36835|IL2_CAPHI:-0.32378):0.09999)";

package/bundle/components/data/seq2.js

@@ -1,3 +0,0 @@
-export var smallMSA = "CLUSTAL O(1.2.3) multiple sequence alignment\nUniProt/Swiss-Prot|P26898|IL2RA_SHEEP      MEPSLLMWRFFVFIVVPGCVTEACHDDPPSLRNA----------MFKVLRYE----VGTM\nUniProt/Swiss-Prot|P01590|IL2RA_MOUSE      MEPRLLMLGFLSLTIVPSCRAELCLYDPPEVPNA----------TFKALSYK----NGTI\nUniProt/Swiss-Prot|P41690|IL2RA_FELCA      MEPSLLLWGILTFVVVHGHVTELCDENPPDIQHA----------TFKALTYK----TGTM\nUniProt/Swiss-Prot|P01589|IL2RA_HUMAN      MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHA----------TFKAMAYK----EGTM\nUniProt/Swiss-Prot|Q5MNY4|IL2RA_MACMU      MDPYLLMWGLLTFITVPGCQAELCDDDPPKITHA----------TFKAVAYK----EGTM\nUniProt/Swiss-Prot|Q95118|IL2RG_BOVIN      -----------------------------------LLMWGLLT-----------------\nUniProt/Swiss-Prot|P40321|IL2RG_CANFA      MLKPPLPLRSLLFLQLSLLGVGLNSTVPMPNGNEDIT------PDFFLTATPSETLSVSS\nUniProt/Swiss-Prot|P26896|IL2RB_RAT        MATVDLSWRLPLYILLLLLATT--------------------------------WVSAAV\nUniProt/Swiss-Prot|Q8BZM1|GLMN_MOUSE       PLPLRSLLFLQLPLLGVGLNP------------------PLPLRSLLFLQLPLLGVGLNP\nUniProt/Swiss-Prot|P36835|IL2_CAPHI        -----------LLGVGLNPKFLTP------------------------------------\nUniProt/Swiss-Prot|Q7JFM4|IL2_AOTVO        MLKPPLPLRSLLFLQLPLLGVGLNPKFLTPSGNEDIGGKPGTGGDFFLTSTPAGTLDVST\nUniProt/Swiss-Prot|Q29416|IL2_CANFA        --------------LFLQLSLLG-------------------------------------\n";
-export var smallMSAOnly = "CLUSTAL O(1.2.4) multiple sequence alignment\n\n\nsp|P69905|HBA_HUMAN       MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG\t60\nsp|P01942|HBA_MOUSE       MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG\t60\nsp|P13786|HBAZ_CAPHI      MSLTRTERTIILSLWSKISTQADVIGTETLERLFSCYPQAKTYFPHFDLHSGSAQLRAHG\t60\n                          * *:  ::: : : *.*:. :.   *:*:***:* .:* :********:  ****::.**\n\nsp|P69905|HBA_HUMAN       KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP\t120\nsp|P01942|HBA_MOUSE       KKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP\t120\nsp|P13786|HBAZ_CAPHI      SKVVAAVGDAVKSIDNVTSALSKLSELHAYVLRVDPVNFKFLSHCLLVTLASHFPADFTA\t120\n                          .**. *: .*.  :*:: .*** **:***: *********:**********:* **:**\n\nsp|P69905|HBA_HUMAN       AVHASLDKFLASVSTVLTSKYR\t142\nsp|P01942|HBA_MOUSE       AVHASLDKFLASVSTVLTSKYR\t142\nsp|P13786|HBAZ_CAPHI      DAHAAWDKFLSIVSGVLTEKYR\t142\n                           .**: ****: ** ***.***";
-export var smallTree = '(((UniProt/Swiss-Prot|P26898|IL2RA_SHEEP:0.24036,(UniProt/Swiss-Prot|P41690|IL2RA_FELCA:0.17737,(UniProt/Swiss-Prot|P01589|IL2RA_HUMAN:0.03906,UniProt/Swiss-Prot|Q5MNY4|IL2RA_MACMU:0.03787):0.13033):0.04964):0.02189,UniProt/Swiss-Prot|P01590|IL2RA_MOUSE:0.23072):0.06814,(((UniProt/Swiss-Prot|Q95118|IL2RG_BOVIN:0.09600,UniProt/Swiss-Prot|P40321|IL2RG_CANFA:0.09845):0.25333,UniProt/Swiss-Prot|Q29416|IL2_CANFA:-0.35055):0.10231,(UniProt/Swiss-Prot|P26896|IL2RB_RAT:0.33631,UniProt/Swiss-Prot|Q7JFM4|IL2_AOTVO:-0.33631):0.10166):0.01607,(UniProt/Swiss-Prot|Q8BZM1|GLMN_MOUSE:0.32378,UniProt/Swiss-Prot|P36835|IL2_CAPHI:-0.32378):0.09999)';

package/bundle/index.d.ts

@@ -1,4 +0,0 @@
-import MSAView from './components/MSAView';
-import MSAModel, { MsaViewModel } from './model';
-export { MSAModel, MSAView };
-export type { MsaViewModel };

package/bundle/layout.d.ts

@@ -1,23 +0,0 @@
-export default class Layout {
-    rectangles: Map<string, {
-        minY: number;
-        maxY: number;
-        minX: number;
-        maxX: number;
-        id: string;
-        data: unknown;
-    }>;
-    maxHeightReached: boolean;
-    private maxHeight;
-    private rbush;
-    private pTotalHeight;
-    constructor({ maxHeight, }?: {
-        maxHeight?: number;
-    });
-    /**
-     * @returns top position for the rect, or Null if laying
-     *  out the rect would exceed maxHeighe
-     */
-    addRect(id: string, left: number, right: number, height: number, data: unknown): number | null;
-    get totalHeight(): number;
-}