oswitch 0.2.3 → 0.2.6

checksums.yaml

@@ -1,7 +1,7 @@
 ---
 SHA1:
-  metadata.gz: 369472acaa650a097470ce6226143df3ffa42ae7
-  data.tar.gz: 203e84b5adda8fcbb4fdca31f4dcc19f3991cfdb
+  metadata.gz: 75af23e839e1c6933df699ecb6e14f5512ce863c
+  data.tar.gz: 902745b152459f284ff363b6897efba8e2c341ab
 SHA512:
-  metadata.gz: df4d46fc352b241cd18559c15d47959e37672dbe0a9a527be2d333e91d90d446e83f9eef3d2631b7206f0c91c5c7ce6d994dc5961dedb913ad92c60ab20aa41c
-  data.tar.gz: 5040d1b5997b6f00def887ffdfe2b18051b6e2a11e753a77f6e8597c0604c7131341d86fcda0a14059047040f41ae15bc239e1c7e3e4dbd72c5e11ae2fa64a65
+  metadata.gz: 9ee1019f702540123b5bcf4305059eb432d00946564f820770d2aeec4dbfc0d220cff2b927f16ab47eddeb9bbdcaf8c69a18c4fea659abaa230ff297dae153d2
+  data.tar.gz: 6c08c54c9bc36fcaf58d2aab8814da44b6ef50b7b6dc41cee1dc6a21a0d22bf42dceb37c9af6540106bcc3c65fc06a28e5c605a275b4710cae7d7c510eacf12b

data/README.mkd

@@ -2,6 +2,28 @@
 
 One-line access to other operating systems.
 
+Mini-example:
+
+```bash
+mymacbook:~/2015-02-01-myproject> abyss-pe
+    zsh: command not found: abyss-pe
+mymacbook:~/2015-02-01-myproject> oswitch -l
+    yeban/biolinux:8
+    ubuntu:14.04
+    ontouchstart/texlive-full
+    ipython/ipython
+    hlapp/rpopgen
+mymacbook:~/2015-02-01-myproject> oswitch biolinux
+    ###### You are now running: biolinux in container biolinux-7187. ######
+biolinux-7187:~/2015-02-01-myproject> abyss-pe k=25 reads.fastq.gz
+    [... just works on your files where they are...]
+biolinux-7187:~/2015-02-01-myproject> exit
+mymacbook:~/2015-02-01-myproject>
+    [... output is where you expect it to be ...]
+```
+
+Detailed information:
+* [Features](#features)
 * [Usage](#example-usage)
 * [Installation](#installation)
 * [FAQ](#faq)
@@ -10,39 +32,40 @@ One-line access to other operating systems.
 
 ## Background
 
-Genomic analyses require using many bioinformatics tools starting from assessing
-the quality of sequenced data and assembly, to annotation, comparison and
-analysis. The data types are young, thus the tools are too and many
-genomicists lack computational training. Thus tools are frequently
-updated yet often challenging to install. Furthermore, software updates often
-involve changes in algorithms or input/output formats, making analyses
-difficult to reproduce. To make matters worse, genomicists often lack
-the skills necessary to setup complex bioinformatics software, and
-systems administrators can be overwhelmed by large numbers of software
-installation requests & the challenges of managing multiple versions.
+Genomic analyses require jumping back and forth between many bioinformatics tools.
+The data types are young, thus so are the tools. This leads to frequent
+updates of tools that are often challenging to install. Furthermore, it is
+challenging to keep different versions of software for different projects, yet
+changing versions can make analyses difficult to reproduce. To make matters worse,
+genomicists often lack the skills necessary to setup complex bioinformatics software,
+and systems administrators can be overwhelmed by large numbers of software
+installation requests.
 
-## Aim & Features
+## Aim
 
 We are developing `oswitch` to enable **seamless switching
 from one operating system to another** - providing access to diverse
-ranges of tools. This project grew from our own need to rapidly access
-software distributed as part of
+ranges of tools. This project grew from our own need to rapidly access 
+diverse pieces of specific versions of software including those distributed as part of
 [BioLinux](http://environmentalomics.org/bio-linux/) on our MacBooks
-and our university HPC system.
-
-For this we take advantage of the [docker](http://docker.io/)
-technology. Docker works by creating "to the specification" image from
-a Dockerfile, which is then run in an isolated
-"container". Dockerfiles or the resulting images can persist forever,
-are easily [shared or published](https://hub.docker.com/), and make
-it possible for anybody to recreate the exact same setup at
-any point of time in the future. This is similar to using virtual
-machine images - but much more
+and our university HPC system. This was previously too difficult, but is
+important for [reproducible research](http://www.software.ac.uk) and agility.
+@bmpvieira made it clear early on that the [docker](http://docker.io/) could
+help make something happen. We first shared the resulting concept during a
+[Balti & Bioinformatics](http://nickloman.github.io/balti/2014/05/01/balti-and-bioinformatics-27th-may-2014/)
+presentation in the form of this (now out of date!) slide:
+
+[![Slide from Balti](http://i.imgur.com/exfDi6a.png)](http://www.slideshare.net/yannickwurm/2014-0527-opinion-computing-for-genomics-sucks)
+
+Docker images feel similar to using virtual machine images - but are much more
 [flexible and light-weight](http://stackoverflow.com/questions/16047306/how-is-docker-io-different-from-a-normal-virtual-machine).
+They are thus easily [shared or published](https://hub.docker.com/). We are extremely lucky to
+be able to build upon this amazing technology.
+
+## Features
 
-`oswitch` is thus a wrapper facilitating access to docker images (without the
-need for ssh-ing). Importantly, when switching operating systems inside a
-shell, most things remain unchanged:
+**`oswitch` is a wrapper facilitating access to docker images**. Importantly, when switching
+operating systems inside a shell, most things remain unchanged:
 
 * Current working directory is maintained
 * User name, uid and gid are maintained
@@ -51,7 +74,7 @@ shell, most things remain unchanged:
   are maintained).
 * read/write permissions are maintained
 * Paths are maintained whenever possible. Thus volumes (external drives,
-NAS) mounted on the host are available in the container at the same
+NAS, USB) mounted on the host are available in the container at the same
 path.
 
 ## Example Usage
@@ -64,11 +87,11 @@ use.
 Minimalist example:
 
 ```shell
-Yannick@n56-169 ~/g/oswitch> uname -a
+Yannick@n56-169 ~/myproject> uname -a
 Darwin n56-169.sbcs.qmul.ac.uk 14.0.0 Darwin Kernel Version 14.0.0: Fri Sep 19 00:26:44 PDT 2014; root:xnu-2782.1.97~2/RELEASE_X86_64 x86_64
-Yannick@n56-169 ~/g/oswitch> oswitch yeban/biolinux:8
+Yannick@n56-169 ~/myproject> oswitch yeban/biolinux
 ### You are now running: biolinux_8, in container: biolinux_8-27182. ###
-Yannick@biolinux_8-27182 ~/g/oswitch> uname -a
+Yannick@biolinux_8-27182 ~/myproject> uname -a
 Linux biolinux_8-27182 3.16.4-tinycore64 #1 SMP Thu Oct 23 16:14:24 UTC 2014 x86_64 x86_64 x86_64 GNU/Linux
 ```
 
@@ -86,10 +109,10 @@ ITKIKLENSDVTIPDIKLIMFPKEPYTADWMLAFRVVIPLYMVLALSQFITYLLILIVGE
 KENKIKEGMKMMGLNDSVF
 pixel:~/test/ $ blastp -query mygene.fa -remote -db nr -outfmt 7 > mygene_blastp_nr.tab
 zsh: command not found: blastp
-# Indeed... blastp is not installed on my MacBook. 
+# Indeed... blastp is missing from my MacBook. 
 
 # Switch to BioLinux and run blastp.
-pixel:~/test/ $ oswitch biolinux
+pixel:~/test/ $ oswitch yeban/biolinux
 ###### You are now running: biolinux in container biolinux-7187. ######
 biolinux-7187:~/test/ $ blastp -query mygene.fa -remote -db nr -outfmt 7 >  mygene_blastp_nr.tab
 # BioLinux includes blastp, thus the command ran smoothly.
@@ -114,6 +137,7 @@ myfavoritegene	gi|328778864|ref|XP_397465.4|	80.60	201	36	2	1	199	95	294	5e-108
 biolinux-7187:~/test/ $ exit
 pixel:~/test/ $ ls 
 mygene.fasta mygene_blastp_nr.txt
+# our newly generated file is where we'd expect it to be.
 ```
 
 ##### Use a package non-interactively
@@ -128,7 +152,7 @@ the exit status of the command run within container is returned.
 
 ```shell
 # Run command directly in BioLinux and view results if success.
-pixel:~/test/ $ oswitch biolinux blastp -remote -query mygene.fa -db nr > mygene_blastp_nr.txt
+pixel:~/test/ $ oswitch yeban/biolinux blastp -remote -query mygene.fa -db nr > mygene_blastp_nr.txt
 ```
 
 ##### Listing available operating system containers
@@ -140,11 +164,14 @@ from docker hub using oswitch as:
 pixel:~ $ oswitch -l
 yeban/biolinux:8
 ubuntu:14.04
+ontouchstart/texlive-full
+ipython/ipython
+hlapp/rpopgen
 ```
 	
 ##### Availability
 
-OSwitch has been tested on:
+We have tested OSwitch on:
 
 * Mac OS X Yosemite
 * Ubuntu 14.04.1
@@ -152,20 +179,57 @@ OSwitch has been tested on:
 
 ##### Caveats
 
-* Works only for Debian, Ubuntu, CentOS based docker images.
+* Some features work only for Debian, Ubuntu, CentOS based docker images.
 * Host directories/volumes with paths conflicting with container paths are
   skipped.
 * SELinux must be disabled on CentOS for mounting volumes to work.
+* [Volume mounting on Mac OS hosts is imperfect](#q-directories-mounted-within-container-on-mac-host-are-empty).
 
 ## Installation
 
-OSwitch first requires a working docker install.
+OSwitch first requires a [working docker install](#Install and setup docker). 
+
+#### Install oswitch
+
+##### Mac
+
+Using [homebrew](http://brew.sh/).
+
+    $ brew install https://raw.githubusercontent.com/yeban/oswitch/master/homebrew/oswitch.rb
+
+Depending on whether Homebrew is installed systemwide or only for your user,
+this will install `oswitch` systemwide or only for your user.
+
+##### Linux
+
+###### Debian / Ubuntu
+
+A `deb` package of `oswitch` is available in BioLinux repository for Trusty,
+Vivid and Jessie.
+
+    $ sudo add-apt-repository ppa:nebc/biolinux
+    $ sudo apt-get update
+    $ sudo apt-get install oswitch
+
+###### Others
+
+Requirements: Ruby 2.0 or higher.
+
+    $ gem install oswitch
 
-#### Install and setup docker
+Depending on whether Ruby is installed systemwide (via your package-manager) or
+only for your user, this will install `oswitch` systemwide or only for your
+user.
+
+#### Test oswitch
+
+    $ oswitch ubuntu:14.04
+
+## Install and setup docker
 
 ##### Mac OS X
 
-Installing docker - https://docs.docker.com/installation/mac/
+Installing docker is much easier than before - https://docs.docker.com/installation/mac/
 
 ##### Ubuntu
 
@@ -209,16 +273,6 @@ The following should give an encouraging message:
 
     $ docker run hello-world
 
-#### Install oswitch
-
-Requirements: Ruby 2.0 or higher.
-
-    $ gem install oswitch
-
-#### Testing oswitch
-
-    $ oswitch ubuntu:14.04
-
 ## FAQ
 
 ##### Q. Directories mounted within container on Mac host are empty.
@@ -257,18 +311,24 @@ tracker](https://github.com/yeban/oswitch/issues) with oswitch's output. If the
 image you are using is not available via docker hub or another public
 repository, please include the Dockerfile as well.
 
+##### Q. How does all this work?
+We create a new image on the fly that inherits from the given image. While creating
+the new image we execute a shell script that installs packages required for
+oswitch to work and creates a user in the image (almost) identical to that on the host.
+
 ## Roadmap
 
 1. ~~make it possible to use docker containers without inheriting our
 current baseimage~~
 2. ~~gem distribution for easier installation~~
-3.  brew recipe for Mac
-4. test on QMUL's compute cluster
-5.  create an SELinux policy to run oswitch on CentOS without having to disable
+3. ~~brew recipe for Mac~~
+4. ~~deb package~~
+5. test on QMUL's compute cluster
+6. make available images for common bioinformatics software
+7. deploy at [RAL/JASMIN](http://www.jasmin.ac.uk)
+8. create an SELinux policy to run oswitch on CentOS without having to disable
 SELinux entirely
-6. rpm and deb packages
-7. make available images for common bioinformatics software
-8. deploy at [RAL/JASMIN](http://www.jasmin.ac.uk)
+9. rpm package
 
 ## Contribute
 
@@ -283,13 +343,13 @@ SELinux entirely
 * [Bruno Vieira](https://github.com/bmpvieira) ([@bmpvieira](//twitter.com/bmpvieira))
 * [Saurabh Kumar](https://github.com/sa1)
 * Richard Nichols - [http://www.sbcs.qmul.ac.uk/staff/richardnichols.html](http://www.sbcs.qmul.ac.uk/staff/richardnichols.html) | [@qmwugbt112](//twitter.com/qmwugbt112)
-* Yannick Wurm  - [http://wurmlab.github.io](http://wurmlab.github.io) |
-  [@yannick__](//twitter.com/yannick__)
+* Yannick Wurm  - [http://wurmlab.github.io](http://wurmlab.github.io) | [@yannick__](//twitter.com/yannick__)
 
 ---
 
 <p align="center">
-  Development funded as part of NERC EOS Cloud at
+  Development funded as part of 
+  <a href="http://environmentalomics.org/portfolio/big-data-infrastructure/">NERC Environmental Omics (EOS) Cloud</a> at<br/>
   <a href="http://wurmlab.github.io/">Wurm Lab</a>,
   <a href="http://sbcs.mul.ac.uk/">Queen Mary University of London</a>.
 </p>

data/lib/oswitch/exceptions.rb

@@ -0,0 +1,18 @@
+class OSwitch
+  class ENOPKG < StandardError
+    def initialize(name)
+      @name = name
+    end
+
+    def to_s
+      "Recipe to run #@name not available."
+    end
+  end
+
+  class ENODKR < StandardError
+    def to_s
+      "***** Docker not installed / correctly setup / running.
+      Are you able to run 'docker info'?"
+    end
+  end
+end

data/lib/oswitch/image.rb

@@ -0,0 +1,33 @@
+class OSwitch
+  # Captures a docker image's metadata.
+  Image = Struct.new :repository, :tag, :id, :created, :size
+
+  class Image
+
+    # Model Image's eigenclass as a collection of Image objects.
+    class << self
+
+      include Enumerable
+
+      def all
+        `docker images`.split("\n").drop(1).
+          map{|l| Image.new(*l.split(/\s{2,}/))}
+      end
+
+      def each(&block)
+        all.each(&block)
+      end
+
+      def get(imgname)
+        repository, tag = imgname.split(':')
+        return if not repository or repository.empty?
+        tag = 'latest' if not tag or tag.empty?
+        find {|img| img.repository == repository and img.tag == tag}
+      end
+
+      def exists?(imgname)
+        !!get(imgname)
+      end
+    end
+  end
+end

data/lib/oswitch/os/darwin.rb

@@ -0,0 +1,30 @@
+class OSwitch
+  module OS
+    # OS X specific code.
+    module Darwin
+      BLACKLIST =
+        %r{
+        ^/$|
+        ^/(bin|cores|dev|etc|home|Incompatible\ Software|
+          installer\.failurerequests|lost\+found|net|
+          Network|opt|private|sbin|System|Users|tmp|
+          usr|var|Volumes$)
+        }x
+
+      def uid
+        `boot2docker ssh id -u`.chomp
+      end
+
+      def gid
+        `boot2docker ssh id -g`.chomp
+      end
+
+      def mountpoints
+        volumes = Dir['/Volumes/*'].map {|v| File.symlink?(v) ? File.readlink(v) : v}
+        volumes = volumes | Dir['/*']
+        volumes.reject! { |mount| mount =~ BLACKLIST }
+        volumes << home
+      end
+    end
+  end
+end

data/lib/oswitch/os/linux.rb

@@ -0,0 +1,45 @@
+class OSwitch
+  module OS
+    # Linux specific code.
+    module Linux
+      BLACKLIST =
+        %r{
+        ^/$|
+        ^/(bin|boot|dev|etc|home|lib|lib64|lost\+found|opt|proc|
+          run(?!/media)|sbin|srv|sys|tmp|usr|var|
+          initrd.img|initrd.img.old|vmlinuz|vmlinuz.old)
+        }x
+
+      def uid
+        Process.uid
+      end
+
+      def gid
+        Process.gid
+      end
+
+      def mountpoints
+        volumes = IO.readlines('/proc/mounts')
+          .map { |line| line.split(/\s+/)[1] }
+          .map { |path| unescape(path)       }
+        volumes = volumes | Dir['/*']
+
+        volumes.reject! do |path|
+          (path =~ BLACKLIST) || !File.readable?(path) || !File.directory?(path)
+        end
+
+        volumes << home
+      end
+
+      private
+
+      def unescape(mount)
+        mount
+          .gsub(/\\040/, " ")
+          .gsub(/\\012/, "\n")
+          .gsub(/\\134/, "\\")
+          .gsub(/\\011/, "\t")
+      end
+    end
+  end
+end

data/lib/oswitch/os.rb

@@ -0,0 +1,40 @@
+class OSwitch
+  # Get OS specific info. Like, what directories to mount in the container,
+  # current user, home directory.
+  #
+  # This module first defines methods common to Linux and Darwin, then does
+  # OS detection and loads OS specific code.
+  module OS
+    def username
+      ENV['USER']
+    end
+
+    def home
+      ENV['HOME']
+    end
+
+    def shell
+      File.basename ENV['SHELL']
+    end
+
+    def cwd
+      Dir.pwd
+    end
+
+    # Detect Linux or Darwin and load OS specific code. Following methods are
+    # added:
+    #
+    #   uid, gid, mountpoints
+    #
+    # NOTE:
+    #   This won't work on JRuby, as it sets RUBY_PLATFORM to 'java'.
+    case RUBY_PLATFORM
+    when /linux/
+      require_relative 'os/linux'
+      include Linux
+    when /darwin/
+      require_relative 'os/darwin'
+      include Darwin
+    end
+  end
+end

data/lib/oswitch/pkg.rb

@@ -0,0 +1,3 @@
+class OSwitch
+  PREFIX = File.expand_path('../..', File.dirname(__FILE__))
+end

data/lib/oswitch.rb

@@ -3,6 +3,11 @@ require 'colorize'
 require 'fileutils'
 require 'shellwords'
 
+require 'oswitch/exceptions'
+require 'oswitch/image'
+require 'oswitch/pkg'
+require 'oswitch/os'
+
 # OSwitch leverages docker to provide access to complex Bioinformatics software
 # (even Biolinux!) in just one command.
 #
@@ -12,129 +17,7 @@ require 'shellwords'
 # Volumes from host OS are mounted in the container just the same, including
 # home directory. USER, HOME, SHELL, and PWD are preserved.
 class OSwitch
-
-  class ENOPKG < StandardError
-
-    def initialize(name)
-      @name = name
-    end
-
-    def to_s
-      "Recipe to run #@name not available."
-    end
-  end
-
-  class ENODKR < StandardError
-
-    def to_s
-      "***** Docker not installed / correctly setup / running.
-      Are you able to run 'docker info'?"
-    end
-  end
-
-  include Timeout
-
-  # Captures a docker image's metadata.
-  Image = Struct.new :repository, :tag, :id, :created, :size
-
-  class Image
-
-    # Model Image's eigenclass as a collection of Image objects.
-    class << self
-
-      include Enumerable
-
-      def all
-        `docker images`.split("\n").drop(1).
-          map{|l| Image.new(*l.split(/\s{2,}/))}
-      end
-
-      def each(&block)
-        all.each(&block)
-      end
-
-      def get(imgname)
-        repository, tag = imgname.split(':')
-        return if not repository or repository.empty?
-        tag = 'latest' if not tag or tag.empty?
-        find {|img| img.repository == repository and img.tag == tag}
-      end
-
-      def exists?(imgname)
-        !!get(imgname)
-      end
-    end
-  end
-
-  # Linux specific code.
-  module Linux
-
-    def uid
-      Process.uid
-    end
-
-    def gid
-      Process.gid
-    end
-
-    # Parse /proc/mounts for mountpoints.
-    def mountpoints
-      mtab = IO.readlines '/proc/mounts'
-      mountpoints = mtab.map{ |line| line.split(/\s+/)[1]}
-      mountpoints.map!{ |mount| unescape(mount) }
-      # Ignore common system mountpoints.
-      mountpoints.reject!{ |mount| mount =~ /^\/$/ }
-      mountpoints.reject!{ |mount| mount =~ /^\/(proc|sys|usr|boot|tmp|dev|var|bin|etc|lib).*/ }
-      # Mount /run/media/* but ignore other /run/ mountpoints.
-      mountpoints.reject!{ |mount| mount =~ /^\/run.*/ unless mount =~ /^\/run\/(media.*)/ }
-
-      # Add home dir.
-      mountpoints << home
-    end
-
-    private
-
-    def unescape(mount)
-      mount.gsub(/\\040/, " ").gsub(/\\012/, "\n").gsub(/\\134/, "\\").gsub(/\\011/, "\t")
-    end
-  end
-
-  # Mac OS X specific code.
-  module Darwin
-
-    BLACKLIST =
-      %r{
-      ^/$|
-      ^/(bin|cores|dev|etc|home|Incompatible\ Software|
-         installer\.failurerequests|lost\+found|net|
-         Network|opt|private|sbin|System|Users|tmp|
-         usr|var|Volumes$)
-      }x
-
-    def uid
-      `boot2docker ssh id -u`.chomp
-    end
-
-    def gid
-      `boot2docker ssh id -g`.chomp
-    end
-
-    def mountpoints
-      volumes = Dir['/Volumes/*'].map {|v| File.symlink?(v) ? File.readlink(v) : v}
-      volumes = volumes | Dir['/*']
-      volumes.reject! { |mount| mount =~ BLACKLIST }
-      volumes << home
-    end
-  end
-
-  # NOTE:
-  #   This won't work on JRuby, as it sets RUBY_PLATFORM to 'java'.
-  case RUBY_PLATFORM
-  when /linux/
-    include Linux
-  when /darwin/
-    include Darwin
-  end
+  include OS, Timeout
 
   DOTDIR = File.expand_path('~/.oswitch')
 
@@ -189,7 +72,8 @@ class OSwitch
 
   def build
     return true if Image.exists? imgname
-    write_context && system("docker build -t #{imgname} #{context_dir}")
+    create_context_dir &&
+      system("docker build -t #{imgname} #{context_dir}") || !remove_context_dir
   end
 
   # Ping docker daemon. Raise error if no response within 10s.
@@ -202,16 +86,16 @@ class OSwitch
 
   ## Code to generate context dir that will be built into a docker image. ##
 
-  # Write data to context dir.
-  def write_context
-    create_context_dir
-    write_dockerfile
-  end
-
   # Create context dir.
   def create_context_dir
     FileUtils.mkdir_p context_dir
     FileUtils.cp_r(template_files, context_dir)
+    write_dockerfile
+  end
+
+  # Remove context dir.
+  def remove_context_dir
+    FileUtils.rm_r(context_dir)
   end
 
   # Write Dockerfile.
@@ -225,7 +109,7 @@ class OSwitch
     data = ["FROM #{package}"]
     data << 'COPY _switch /'
     data << 'COPY wheel /etc/sudoers.d/'
-    data << "RUN /_switch #{userargs} 2>&1 | tee /tmp/oswitch.log"
+    data << "RUN /_switch #{userargs} 2>&1"
     data << 'ENV LC_ALL en_US.UTF-8'
     data << "USER #{username}"
     data << "ENTRYPOINT [\"#{shell}\", \"-c\"]"
@@ -239,7 +123,7 @@ class OSwitch
 
   # Location of template dir.
   def template_dir
-    File.expand_path('../context/', File.dirname(__FILE__))
+    File.join(PREFIX, 'share', 'oswitch', 'context')
   end
 
   # Template files.
@@ -247,24 +131,6 @@ class OSwitch
     Dir[File.join(template_dir, '*')]
   end
 
-
-  ## Data required to switchify a container. ##
-  def username
-    ENV['USER']
-  end
-
-  def home
-    ENV['HOME']
-  end
-
-  def shell
-    File.basename ENV['SHELL']
-  end
-
-  def cwd
-    Dir.pwd
-  end
-
   def motd
     str =<<MOTD
 ################################################################################
@@ -282,7 +148,7 @@ safest to write to.
 Press Ctrl-D or type 'exit' to go back.
 ################################################################################
 MOTD
-    str.blue.shellescape
+    str.shellescape
   end
 
   def mountargs

data/oswitch.gemspec

@@ -1,7 +1,7 @@
 Gem::Specification.new do |s|
   # meta
   s.name        = 'oswitch'
-  s.version     = '0.2.3'
+  s.version     = '0.2.6'
   s.authors     = ['Anurag Priyam', 'Bruno Vieira', 'Yannick Wurm']
   s.email       = ['anurag08priyam@gmail.com']
   s.homepage    = 'https://github.com/yeban/oswitch'
@@ -20,7 +20,7 @@ DESC
   s.required_ruby_version =       '>= 2.0'
 
   # gem
-  s.files         = Dir['lib/**/*'] + Dir['context/**/*']
+  s.files         = Dir['lib/**/*'] + Dir['share/**/*']
   s.files         = s.files + ['Gemfile', 'oswitch.gemspec']
   s.files         = s.files + ['README.mkd']
   s.require_paths = ['lib']

metadata

@@ -1,7 +1,7 @@
 --- !ruby/object:Gem::Specification
 name: oswitch
 version: !ruby/object:Gem::Version
-  version: 0.2.3
+  version: 0.2.6
 platform: ruby
 authors:
 - Anurag Priyam
@@ -10,7 +10,7 @@ authors:
 autorequire: 
 bindir: bin
 cert_chain: []
-date: 2015-02-20 00:00:00.000000000 Z
+date: 2015-09-15 00:00:00.000000000 Z
 dependencies:
 - !ruby/object:Gem::Dependency
   name: colorize
@@ -40,10 +40,16 @@ files:
 - Gemfile
 - README.mkd
 - bin/oswitch
-- context/_switch
-- context/wheel
 - lib/oswitch.rb
+- lib/oswitch/exceptions.rb
+- lib/oswitch/image.rb
+- lib/oswitch/os.rb
+- lib/oswitch/os/darwin.rb
+- lib/oswitch/os/linux.rb
+- lib/oswitch/pkg.rb
 - oswitch.gemspec
+- share/oswitch/context/_switch
+- share/oswitch/context/wheel
 homepage: https://github.com/yeban/oswitch
 licenses:
 - MIT
@@ -70,3 +76,4 @@ specification_version: 4
 summary: Use docker image as the host operating system's user and access host operating
   system's filesystem.
 test_files: []
+has_rdoc: