biolmai 0.1.4__tar.gz → 0.1.5__tar.gz

{biolmai-0.1.4 → biolmai-0.1.5}/PKG-INFO

@@ -1,6 +1,6 @@
 Metadata-Version: 2.1
 Name: biolmai
-Version: 0.1.4
+Version: 0.1.5
 Summary: Python client and SDK for https://biolm.ai
 Home-page: https://github.com/BioLM/py-biolm
 Author: Nikhil Haas

biolmai-0.1.5/biolmai/__init__.py

@@ -0,0 +1,11 @@
+"""Top-level package for BioLM AI."""
+__author__ = """Nikhil Haas"""
+__email__ = 'nikhil@biolm.ai'
+__version__ = '0.1.5'
+
+from biolmai.auth import get_api_token
+from biolmai.cls import ESMFoldSingleChain, ESMFoldMultiChain, ESM2Embeddings, ESM1v1, ESM1v2, ESM1v3, ESM1v4, ESM1v5
+
+__all__ = [
+
+]

{biolmai-0.1.4 → biolmai-0.1.5}/biolmai/api.py

@@ -1,100 +1,22 @@
 """References to API endpoints."""
-from biolmai import biolmai
+import datetime
+import time
+
+import requests
+from requests.adapters import HTTPAdapter
+
+import biolmai.auth
+import biolmai
 import inspect
 import pandas as pd
 import numpy as np
-from asyncio import create_task, gather, run, sleep
-from biolmai.asynch import async_main, async_api_calls
+from biolmai.asynch import async_api_call_wrapper
 
-from biolmai.biolmai import get_user_auth_header
+from biolmai.biolmai import log
 from biolmai.const import MULTIPROCESS_THREADS
 from functools import lru_cache
 
-from biolmai.payloads import INST_DAT_TXT
-from biolmai.validate import ExtendedAAPlusExtra, SingleOccurrenceOf, \
-    UnambiguousAA, \
-    UnambiguousAAPlusExtra
-
-
-def predict_resp_many_in_one_to_many_singles(resp_json, status_code,
-                                             batch_id, local_err, batch_size):
-    expected_root_key = 'predictions'
-    to_ret = []
-    if not local_err and status_code and status_code == 200:
-        list_of_individual_seq_results = resp_json[expected_root_key]
-    elif local_err:
-        list_of_individual_seq_results = [{'error': resp_json}]
-    elif status_code and status_code != 200 and isinstance(resp_json, dict):
-        list_of_individual_seq_results = [resp_json] * batch_size
-    else:
-        raise ValueError("Unexpected response in parser")
-    for idx, item in enumerate(list_of_individual_seq_results):
-        d = {'status_code': status_code,
-             'batch_id': batch_id,
-             'batch_item': idx}
-        if not status_code or status_code != 200:
-            d.update(item)  # Put all resp keys at root there
-        else:
-            # We just append one item, mimicking a single seq in POST req/resp
-            d[expected_root_key] = []
-            d[expected_root_key].append(item)
-        to_ret.append(d)
-    return to_ret
-
-
-def async_api_call_wrapper(grouped_df, slug, action, payload_maker,
-                           response_key):
-    """Wrap API calls to assist with sequence validation as a pre-cursor to
-    each API call.
-    """
-    model_name = slug
-    # payload = payload_maker(grouped_df)
-    init_ploads = grouped_df.groupby('batch').apply(payload_maker, include_batch_size=True)
-    ploads = init_ploads.to_list()
-    init_ploads = init_ploads.to_frame(name='pload')
-    init_ploads['batch'] = init_ploads.index
-    init_ploads = init_ploads.reset_index(drop=True)
-    assert len(ploads) == init_ploads.shape[0]
-    for inst, b in zip(ploads, init_ploads['batch'].to_list()):
-        inst['batch'] = b
-
-    headers = get_user_auth_header()  # Need to pull each time
-    urls = [
-        "https://github.com",
-        "https://stackoverflow.com",
-        "https://python.org",
-    ]
-    # concurrency = 3
-    api_resp = run(async_api_calls(model_name, action, headers,
-                                   ploads, response_key))
-    api_resp = [item for sublist in api_resp for item in sublist]
-    api_resp = sorted(api_resp, key=lambda x: x['batch_id'])
-    # print(api_resp)
-    # api_resp = biolmai.api_call(model_name, action, headers, payload,
-    #                             response_key)
-    # resp_json = api_resp.json()
-    # batch_id = int(grouped_df.batch.iloc[0])
-    # batch_size = grouped_df.shape[0]
-    # response = predict_resp_many_in_one_to_many_singles(
-    #     resp_json, api_resp.status_code, batch_id, None, batch_size)
-    return api_resp
-
-
-def api_call_wrapper(df, args):
-    """Wrap API calls to assist with sequence validation as a pre-cursor to
-    each API call.
-    """
-    model_name, action, payload_maker, response_key = args
-    payload = payload_maker(df)
-    headers = get_user_auth_header()  # Need to pull each time
-    api_resp = biolmai.api_call(model_name, action, headers, payload,
-                                response_key)
-    resp_json = api_resp.json()
-    batch_id = int(df.batch.iloc[0])
-    batch_size = df.shape[0]
-    response = predict_resp_many_in_one_to_many_singles(
-        resp_json, api_resp.status_code, batch_id, None, batch_size)
-    return response
+from biolmai.payloads import INST_DAT_TXT, predict_resp_many_in_one_to_many_singles
 
 
 @lru_cache(maxsize=64)
@@ -131,7 +53,8 @@ def validate(f):
 
         # Is the function we decorated a class method?
         if is_method:
-            name = '{}.{}.{}'.format(f.__module__, args[0].__class__.__name__,
+            name = '{}.{}.{}'.format(f.__module__,
+                                     class_obj_self.__class__.__name__,
                                      f.__name__)
         else:
             name = '{}.{}'.format(f.__module__, f.__name__)
@@ -211,14 +134,12 @@ class APIEndpoint(object):
         else:
             self.multiprocess_threads = MULTIPROCESS_THREADS  # Could be False
         # Get correct auth-like headers
-        self.auth_headers = biolmai.get_user_auth_header()
+        self.auth_headers = biolmai.auth.get_user_auth_header()
         self.action_class_strings = tuple([
             c.__name__.replace('Action', '').lower() for c in self.action_classes
         ])
 
-    @convert_input
-    @validate
-    def predict(self, dat):
+    def post_batches(self, dat, slug, action, payload_maker, resp_key):
         keep_batches = dat.loc[~dat.batch.isnull(), ['text', 'batch']]
         if keep_batches.shape[0] == 0:
             pass  # Do nothing - we made nice JSON errors to return in the DF
@@ -227,10 +148,10 @@ class APIEndpoint(object):
         if keep_batches.shape[0] > 0:
             api_resps = async_api_call_wrapper(
                 keep_batches,
-                self.slug,
-                'predict',
-                INST_DAT_TXT,
-                'predictions'
+                slug,
+                action,
+                payload_maker,
+                resp_key
             )
             if isinstance(api_resps, pd.DataFrame):
                 batch_res = api_resps.explode('api_resp')  # Should be lists of results
@@ -253,28 +174,100 @@ class APIEndpoint(object):
             dat = dat.join(keep_batches.reindex(['api_resp'], axis=1))
         else:
             dat['api_resp'] = None
+        return dat
 
+    def unpack_local_validations(self, dat):
         dat.loc[
             dat.api_resp.isnull(), 'api_resp'
         ] = dat.loc[~dat.validation.isnull(), 'validation'].apply(
             predict_resp_many_in_one_to_many_singles,
             args=(None, None, True, None)).explode()
 
+        return dat
+
+    @convert_input
+    @validate
+    def predict(self, dat):
+        dat = self.post_batches(dat, self.slug, 'predict', INST_DAT_TXT, 'predictions')
+        dat = self.unpack_local_validations(dat)
         return dat.api_resp.replace(np.nan, None).tolist()
 
     def infer(self, dat):
         return self.predict(dat)
 
+    @convert_input
     @validate
-    def tokenize(self, dat):
-        payload = {"instances": [{"data": {"text": dat}}]}
-        resp = biolmai.api_call(
-            model_name=self.slug,
-            headers=self.auth_headers,  # From APIEndpoint base class
-            action='transform',
-            payload=payload
-        )
-        return resp
+    def transform(self, dat):
+        dat = self.post_batches(dat, self.slug, 'transform', INST_DAT_TXT, 'predictions')
+        dat = self.unpack_local_validations(dat)
+        return dat.api_resp.replace(np.nan, None).tolist()
+
+    @convert_input
+    @validate
+    def generate(self, dat):
+        dat = self.post_batches(dat, self.slug, 'generate', INST_DAT_TXT, 'generated')
+        dat = self.unpack_local_validations(dat)
+        return dat.api_resp.replace(np.nan, None).tolist()
+
+
+def retry_minutes(sess, URL, HEADERS, dat, timeout, mins):
+    """Retry for N minutes."""
+    HEADERS.update({'Content-Type': 'application/json'})
+    attempts, max_attempts = 0, 5
+    try:
+        now = datetime.datetime.now()
+        try_until = now + datetime.timedelta(minutes=mins)
+        while datetime.datetime.now() < try_until and attempts < max_attempts:
+            response = None
+            try:
+                log.info('Trying {}'.format(datetime.datetime.now()))
+                response = sess.post(
+                    URL,
+                    headers=HEADERS,
+                    data=dat,
+                    timeout=timeout
+                )
+                if response.status_code not in (400, 404):
+                    response.raise_for_status()
+                if 'error' in response.json():
+                    raise ValueError(response.json().dumps())
+                else:
+                    break
+            except Exception as e:
+                log.warning(e)
+                if response:
+                    log.warning(response.text)
+                time.sleep(5)  # Wait 5 seconds between tries
+            attempts += 1
+        if response is None:
+            err = "Got Nonetype response"
+            raise ValueError(err)
+        elif 'Server Error' in response.text:
+            err = "Got Server Error"
+            raise ValueError(err)
+    except Exception as e:
+        return response
+    return response
+
+
+def requests_retry_session(
+    retries=3,
+    backoff_factor=0.3,
+    status_forcelist=list(range(400, 599)),
+    session=None,
+):
+    session = session or requests.Session()
+    retry = Retry(
+        total=retries,
+        read=retries,
+        connect=retries,
+        backoff_factor=backoff_factor,
+        status_forcelist=status_forcelist
+    )
+    adapter = HTTPAdapter(max_retries=retry)
+    session.mount('http://', adapter)
+    session.mount('https://', adapter)
+    return session
 
 
 class PredictAction(object):
@@ -311,84 +304,3 @@ class FinetuneAction(object):
 
     def __str__(self):
         return 'FinetuneAction'
-
-
-class ESMFoldSingleChain(APIEndpoint):
-    slug = 'esmfold-singlechain'
-    action_classes = (PredictAction, )
-    seq_classes = (UnambiguousAA(), )
-    batch_size = 2
-
-
-class ESMFoldMultiChain(APIEndpoint):
-    slug = 'esmfold-multichain'
-    action_classes = (PredictAction, )
-    seq_classes = (ExtendedAAPlusExtra(extra=[':']), )
-    batch_size = 2
-
-
-class ESM2Embeddings(APIEndpoint):
-    """Example.
-
-    ```python
-    {
-      "instances": [{
-        "data": {"text": "MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGQQLPQ"}
-      }]
-    }
-    ```
-    """
-    slug = 'esm2_t33_650M_UR50D'
-    action_classes = (TransformAction,)
-    seq_classes = (UnambiguousAA(), )
-    batch_size = 3
-
-
-class ESM1v1(APIEndpoint):
-    """Example.
-
-    ```python
-    {
-      "instances": [{
-        "data": {"text": "QERLEUTGR<mask>SLGYNIVAT"}
-      }]
-    }
-    ```
-    """
-    slug = 'esm1v_t33_650M_UR90S_1'
-    action_classes = (PredictAction, )
-    seq_classes = (SingleOccurrenceOf('<mask>'),
-                   ExtendedAAPlusExtra(extra=['<mask>']))
-    batch_size = 5
-
-
-class ESM1v2(APIEndpoint):
-    slug = 'esm1v_t33_650M_UR90S_2'
-    action_classes = (PredictAction, )
-    seq_classes = (SingleOccurrenceOf('<mask>'),
-                   ExtendedAAPlusExtra(extra=['<mask>']))
-    batch_size = 5
-
-
-class ESM1v3(APIEndpoint):
-    slug = 'esm1v_t33_650M_UR90S_3'
-    action_classes = (PredictAction, )
-    seq_classes = (SingleOccurrenceOf('<mask>'),
-                   ExtendedAAPlusExtra(extra=['<mask>']))
-    batch_size = 5
-
-
-class ESM1v4(APIEndpoint):
-    slug = 'esm1v_t33_650M_UR90S_4'
-    action_classes = (PredictAction, )
-    seq_classes = (SingleOccurrenceOf('<mask>'),
-                   ExtendedAAPlusExtra(extra=['<mask>']))
-    batch_size = 5
-
-
-class ESM1v5(APIEndpoint):
-    slug = 'esm1v_t33_650M_UR90S_5'
-    action_classes = (PredictAction, )
-    seq_classes = (SingleOccurrenceOf('<mask>'),
-                   ExtendedAAPlusExtra(extra=['<mask>']))
-    batch_size = 5

{biolmai-0.1.4 → biolmai-0.1.5}/biolmai/asynch.py

@@ -1,5 +1,6 @@
 import aiohttp.resolver
 
+from biolmai.auth import get_user_auth_header
 from biolmai.const import BASE_API_URL, MULTIPROCESS_THREADS
 
 aiohttp.resolver.DefaultResolver = aiohttp.resolver.AsyncResolver
@@ -39,7 +40,7 @@ async def get_one_biolm(session: ClientSession,
     pload_batch = pload.pop('batch')
     pload_batch_size = pload.pop('batch_size')
     t = aiohttp.ClientTimeout(
-        total=1200,
+        total=1600,  # 27 mins
         # total timeout (time consists connection establishment for a new connection or waiting for a free connection from a pool if pool connection limits are exceeded) default value is 5 minutes, set to `None` or `0` for unlimited timeout
         sock_connect=None,
         # Maximal number of seconds for connecting to a peer for a new connection, not given from a pool. See also connect.
@@ -183,3 +184,41 @@ async def async_api_calls(model_name,
     #     headers = get_user_auth_header()  # Need to re-get these now
     #     response = retry_minutes(session, url, headers, payload, tout, mins=10)
     # return response
+
+
+def async_api_call_wrapper(grouped_df, slug, action, payload_maker,
+                           response_key):
+    """Wrap API calls to assist with sequence validation as a pre-cursor to
+    each API call.
+    """
+    model_name = slug
+    # payload = payload_maker(grouped_df)
+    init_ploads = grouped_df.groupby('batch').apply(payload_maker, include_batch_size=True)
+    ploads = init_ploads.to_list()
+    init_ploads = init_ploads.to_frame(name='pload')
+    init_ploads['batch'] = init_ploads.index
+    init_ploads = init_ploads.reset_index(drop=True)
+    assert len(ploads) == init_ploads.shape[0]
+    for inst, b in zip(ploads, init_ploads['batch'].to_list()):
+        inst['batch'] = b
+
+    headers = get_user_auth_header()  # Need to pull each time
+    urls = [
+        "https://github.com",
+        "https://stackoverflow.com",
+        "https://python.org",
+    ]
+    # concurrency = 3
+    api_resp = run(async_api_calls(model_name, action, headers,
+                                   ploads, response_key))
+    api_resp = [item for sublist in api_resp for item in sublist]
+    api_resp = sorted(api_resp, key=lambda x: x['batch_id'])
+    # print(api_resp)
+    # api_resp = biolmai.api_call(model_name, action, headers, payload,
+    #                             response_key)
+    # resp_json = api_resp.json()
+    # batch_id = int(grouped_df.batch.iloc[0])
+    # batch_size = grouped_df.shape[0]
+    # response = predict_resp_many_in_one_to_many_singles(
+    #     resp_json, api_resp.status_code, batch_id, None, batch_size)
+    return api_resp

{biolmai-0.1.4 → biolmai-0.1.5}/biolmai/auth.py

@@ -125,3 +125,46 @@ def save_access_refresh_token(access_refresh_dict):
     access = access_refresh_dict.get('access')
     refresh = access_refresh_dict.get('refresh')
     validate_user_auth(access=access, refresh=refresh)
+
+
+def get_api_token():
+    """Get a BioLM API token to use with future API requests.
+
+    Copied from https://api.biolm.ai/#d7f87dfd-321f-45ae-99b6-eb203519ddeb.
+    """
+    url = "https://biolm.ai/api/auth/token/"
+
+    payload = json.dumps({
+        "username": os.environ.get("BIOLM_USER"),
+        "password": os.environ.get("BIOLM_PASSWORD")
+    })
+    headers = {
+        'Content-Type': 'application/json'
+    }
+
+    response = requests.request("POST", url, headers=headers, data=payload)
+    response_json = response.json()
+
+    return response_json
+
+
+def get_user_auth_header():
+    """Returns a dict with the appropriate Authorization header, either using
+    an API token from BIOLMAI_TOKEN environment variable, or by reading the
+    credentials file at ~/.biolmai/credntials next."""
+    api_token = os.environ.get('BIOLMAI_TOKEN', None)
+    if api_token:
+        headers = {'Authorization': f'Token {api_token}'}
+    elif os.path.exists(ACCESS_TOK_PATH):
+        with open(ACCESS_TOK_PATH, 'r') as f:
+            access_refresh_dict = json.load(f)
+        access = access_refresh_dict.get('access')
+        refresh = access_refresh_dict.get('refresh')
+        headers = {
+            'Cookie': 'access={};refresh={}'.format(access, refresh),
+            'Content-Type': 'application/json'
+        }
+    else:
+        err = "No https://biolm.ai credentials found. Please run `biolmai status` to debug."
+        raise AssertionError(err)
+    return headers

biolmai-0.1.5/biolmai/biolmai.py

@@ -0,0 +1,7 @@
+"""Main module."""
+
+import logging
+
+log = logging.getLogger('biolm_util')
+
+

biolmai-0.1.5/biolmai/cls.py

@@ -0,0 +1,100 @@
+"""API inference classes."""
+from biolmai.api import APIEndpoint, PredictAction, TransformAction, GenerateAction
+from biolmai.validate import UnambiguousAA, ExtendedAAPlusExtra, SingleOccurrenceOf
+
+
+class ESMFoldSingleChain(APIEndpoint):
+    slug = 'esmfold-singlechain'
+    action_classes = (PredictAction, )
+    seq_classes = (UnambiguousAA(), )
+    batch_size = 2
+
+
+class ESMFoldMultiChain(APIEndpoint):
+    slug = 'esmfold-multichain'
+    action_classes = (PredictAction, )
+    seq_classes = (ExtendedAAPlusExtra(extra=[':']), )
+    batch_size = 2
+
+
+class ESM2Embeddings(APIEndpoint):
+    """Example.
+
+    .. highlight:: python
+    .. code-block:: python
+
+       {
+         "instances": [{
+           "data": {"text": "MSILVTRPSPAGEELVSRLRTLGQVAWHFPLIEFSPGQQLPQ"}
+         }]
+       }
+    """
+    slug = 'esm2_t33_650M_UR50D'
+    action_classes = (TransformAction,)
+    seq_classes = (UnambiguousAA(), )
+    batch_size = 1
+
+
+class ESM1v1(APIEndpoint):
+    """Example.
+
+    .. highlight:: python
+    .. code-block:: python
+
+       {
+          "instances": [{
+            "data": {"text": "QERLEUTGR<mask>SLGYNIVAT"}
+          }]
+       }
+    """
+    slug = 'esm1v_t33_650M_UR90S_1'
+    action_classes = (PredictAction, )
+    seq_classes = (SingleOccurrenceOf('<mask>'),
+                   ExtendedAAPlusExtra(extra=['<mask>']))
+    batch_size = 5
+
+
+class ESM1v2(APIEndpoint):
+    slug = 'esm1v_t33_650M_UR90S_2'
+    action_classes = (PredictAction, )
+    seq_classes = (SingleOccurrenceOf('<mask>'),
+                   ExtendedAAPlusExtra(extra=['<mask>']))
+    batch_size = 5
+
+
+class ESM1v3(APIEndpoint):
+    slug = 'esm1v_t33_650M_UR90S_3'
+    action_classes = (PredictAction, )
+    seq_classes = (SingleOccurrenceOf('<mask>'),
+                   ExtendedAAPlusExtra(extra=['<mask>']))
+    batch_size = 5
+
+
+class ESM1v4(APIEndpoint):
+    slug = 'esm1v_t33_650M_UR90S_4'
+    action_classes = (PredictAction, )
+    seq_classes = (SingleOccurrenceOf('<mask>'),
+                   ExtendedAAPlusExtra(extra=['<mask>']))
+    batch_size = 5
+
+
+class ESM1v5(APIEndpoint):
+    slug = 'esm1v_t33_650M_UR90S_5'
+    action_classes = (PredictAction, )
+    seq_classes = (SingleOccurrenceOf('<mask>'),
+                   ExtendedAAPlusExtra(extra=['<mask>']))
+    batch_size = 5
+
+
+class ESMIF1(APIEndpoint):
+    slug = 'esmif1'
+    action_classes = (GenerateAction, )
+    seq_classes = tuple([])
+    batch_size = 2
+
+
+class Progen2(APIEndpoint):
+    slug = 'progen2'
+    action_classes = (GenerateAction, )
+    seq_classes = tuple([])
+    batch_size = 1

biolmai-0.1.5/biolmai/payloads.py

@@ -0,0 +1,34 @@
+def INST_DAT_TXT(batch, include_batch_size=False):
+    d = {"instances": []}
+    for idx, row in batch.iterrows():
+        inst = {"data": {"text": row.text}}
+        d['instances'].append(inst)
+    if include_batch_size is True:
+        d['batch_size'] = len(d['instances'])
+    return d
+
+
+def predict_resp_many_in_one_to_many_singles(resp_json, status_code,
+                                             batch_id, local_err, batch_size):
+    expected_root_key = 'predictions'
+    to_ret = []
+    if not local_err and status_code and status_code == 200:
+        list_of_individual_seq_results = resp_json[expected_root_key]
+    elif local_err:
+        list_of_individual_seq_results = [{'error': resp_json}]
+    elif status_code and status_code != 200 and isinstance(resp_json, dict):
+        list_of_individual_seq_results = [resp_json] * batch_size
+    else:
+        raise ValueError("Unexpected response in parser")
+    for idx, item in enumerate(list_of_individual_seq_results):
+        d = {'status_code': status_code,
+             'batch_id': batch_id,
+             'batch_item': idx}
+        if not status_code or status_code != 200:
+            d.update(item)  # Put all resp keys at root there
+        else:
+            # We just append one item, mimicking a single seq in POST req/resp
+            d[expected_root_key] = []
+            d[expected_root_key].append(item)
+        to_ret.append(d)
+    return to_ret

{biolmai-0.1.4 → biolmai-0.1.5}/biolmai.egg-info/PKG-INFO

@@ -1,6 +1,6 @@
 Metadata-Version: 2.1
 Name: biolmai
-Version: 0.1.4
+Version: 0.1.5
 Summary: Python client and SDK for https://biolm.ai
 Home-page: https://github.com/BioLM/py-biolm
 Author: Nikhil Haas

{biolmai-0.1.4 → biolmai-0.1.5}/biolmai.egg-info/SOURCES.txt

@@ -30,11 +30,24 @@ docs/conf.py
 docs/index.rst
 docs/make.bat
 docs/modules.rst
+docs/_static/api_reference_icon.png
 docs/_static/biolm_docs_logo_dark.png
 docs/_static/biolm_docs_logo_light.png
-docs/model-docs/admonitions.rst
-docs/model-docs/esm2_embeddings.rst
-docs/model-docs/esm2_fold.rst
+docs/_static/chat_agents_icon.png
+docs/_static/jupyter_notebooks_icon.png
+docs/_static/model_docs_icon.png
+docs/_static/python_sdk_icon.png
+docs/_static/tutorials_icon.png
+docs/model-docs/ESM-InverseFold.rst
+docs/model-docs/Progen-2-OAS.rst
+docs/model-docs/Progen-2_BFD90.rst
+docs/model-docs/Progen-2_Medium.rst
+docs/model-docs/ProteInfer_EC.rst
+docs/model-docs/ProteInfer_GO.rst
+docs/model-docs/esm_1v_masking.rst
+docs/model-docs/index.rst
+docs/model-docs/esm_suite/esm2_embeddings.rst
+docs/model-docs/esm_suite/esm2_fold.rst
 docs/model-docs/img/book_icon.png
 docs/model-docs/img/esmfold_perf.png
 docs/python-client/authors.rst

{biolmai-0.1.4 → biolmai-0.1.5}/docs/conf.py

@@ -36,6 +36,7 @@ extensions = [
     'sphinx.ext.viewcode',
     'sphinx_copybutton',
     'sphinx_inline_tabs',
+    'sphinx.ext.autosectionlabel',
     'sphinxext.opengraph',
     'sphinx_design',
     'myst_parser'